Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046854 (Pip5kl1)
Chromosomal location
Chr 2: 32431238 - 32439302 (+)
Description
phosphatidylinositol-4-phosphate 5-kinase-like 1 Gene [Source:MGI (curated);Acc:Pip5kl1-001]
RefSeq_dna
NM_198191 
RefSeq_peptide
NP_937834.1 
UniGene
Mm.78923 
MGI
MGI:2448520 
Uniprot/SWISSPROT
Q6U7H8 
Human Ortholog
ENSG00000167103 (PIP5KL1)
Omim not available
UniTrap UNI13050
Vector Insertion
Chr 2: 32438792 - 32439292
Public Clones CMHD-GT_359A6-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100188
Sequence
AGAGAAGCGGCACCTGGGGGCGATGGCCACACCAAGCCTTAGGTCCCACGAGGTAGGTGCGGACCAGAGAGGGGACAAGAAAGGGAAGGGTGAAAGTCTG

GCCATTACCTTGGCCAGAGGCTTGAACACCCCCCCGCCCCGTCTCTGCTCTGGGAAGATCAAGACACGCCCCACGGAG ATCCCGGCCCACTCCCAGGAG

GCTGGAAACAAGTCCATTTCCTCAGGGAGCCGCCGCGGCCTTCTTTGGCACCTCCGAGCCAGGCAGTCTAGAGTTGGCCTGTTTGAGGTCGGTCCAGGAC

ATGAGCTGCATAGAATGACACGAATGATGCAGGAAGGGCTGTGGGCTGCCACCCAGGTCTCCAAGAACAACCCACCCACG GGACCTACTACCCAGAAGG

ATTACCTGGAAGTCATGACCCAAGTTCACGAAGAG GGCTTCGAGCTGGGCACCTTGGCTGGCCCGGCTTTTGCACGGCTGAGGAAATCCATTGGCCTGA

CTGAAGAGGACTACCAGGCTACTCTTGGCCCTGGTGATCCCTACCTTCAATTCTTCAGCACCTCCAAAAGCAAGGCCAGCTTCTTCCTGAC CCACGACC

AGCGCTTCTTTGTGAAGACCCAACGGCGCCACGAAGTGCATGTGCTGCTTGCCCACCTGCCCCGCTATGTGGAGCACCTGCAGCAATACCCACACTCCCT

GCTGGCACGGTTGCTGG GCGTATACAGTCTGCGGGTAGCTCAGGGGAAAAAG AAGTACTTCATCATCATGCAGTGCATCTTCTACCCTACCAGCCGCA

TTTCTGAGAG GTATGACATCAAGGGCTGCAACATAAGCCGCTGGGTAGATCCAGCCCCTGAGGGCAGCCCCCTTGTCTTGGTGCTGAAGGACCTCAACT

TTCAAGAAAAGACCATGAGATTGG GAGCCCAGCGGAGCTGGTTCCTCCGGCAGATGGAGCTAGACACCGCCTTCCTGCGGGAGGTGAATGTACTGGATT

ACAGCCTCCTGGTGGCCATCCAGTTTCTCCACGAAGACGAGAAGGGCATTCACCACTCTGTCTTCAGCACATTCAA AAGAACCGTCACTCCCGCTATGC

TGGCCATGGCCCTCACTGAGACCACGCACTGACTCTTGACCATGAAGGCTCAGAGAAGGGAAGGGAAGCCAAAGGACTCTGCTCTAATTACACTTCTCTA

AGGCGCACCCCTGGGGTTGACCAGTAAGCCCATTTGCGACTTCAAGCCTACCAGATGTGCCCTAAAGTACACCTTTAATCCCAGCACCCAGGAAACAGAG

CCAG - UNI13050 - GTCCATACAAGGTGTGTCGAAGTCGAAGGGAACGGGGGACCAGAACTGCCGGATGCTGCCCGACCTTCCCAATGCCCTCCAT

ATCTTGGACGGGCCAGACCAACGCTATTTTCTGGGCTTAGTGGATATGACTACCGTGTATGGGTTTCGCAAACGGCTGGAACATGTGTGGAAGATGGTAC

GCTATCCAGGCCAGAGCGTCTCCACTGTCAGCCCGGCTCACTACGCCCGTCGCCTCTGTCGGTGGGCAGAGGTGCACACAGAATGACTCACGTGTCTGCC

TTCTTCCCTTATGGACAATGCGCCGGCAACTATTCTGCAGCTGTACCCAGGGAGCTAGCCTGCAGTTCATCCTACCAGCCACCAGAGGGAAGCACCCTCA

TAACTAATGCTGTGAAGACTCAGCCCCATTCGGTGACGGTGCTGTACCCTGCATAGAGCAAGGACCCTGACCCCAACCCTTAGCTCATTTACTATTAAAA

AATGTTGATATTCTCTT
Translation
MATPSLRSHEVGADQRGDKKGKGESLAITLARGLNTPPPRLCSGKIKTRPTE IPAHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHELHRMT

RMMQEGLWAATQVSKNNPPT GPTTQKDYLEVMTQVHEE GFELGTLAGPAFARLRKSIGLTEEDYQATLGPGDPYLQFFSTSKSKASFFLT THDQRFF

VKTQRRHEVHVLLAHLPRYVEHLQQYPHSLLARLLG GVYSLRVAQGKK KYFIIMQCIFYPTSRISER RYDIKGCNISRWVDPAPEGSPLVLVLKDLN

FQEKTMRLG GAQRSWFLRQMELDTAFLREVNVLDYSLLVAIQFLHEDEKGIHHSVFSTFK KRTVTPAMLAMALTETTH - UNI13050 - 
Transcript ENSMUST00000095046
Sequence
GGCAAAGGCAAGCGCCCCTTTCGAAGATTGGGCACAGTGGTAACAAGAGCGTCGCGATTGGTCGTTCGCCATGCAGAGGCGGGGCCTGATTCCTGCATCT

GGGCCTCCGAGACACCGCCAAAGCCAGAGAAGCGGCACCTGGGGGCGATGGCCACACCAAGCCTTAGGTCCCACGAG ATCCCGGCCCACTCCCAGGAGG

CTGGAAACAAGTCCATTTCCTCAGGGAGCCGCCGCGGCCTTCTTTGGCACCTCCGAGCCAGGCAGTCTAGAGTTGGCCTGTTTGAGGTCGGTCCAGGACA

TGAGCTGCATAGAATGACACGAATGATGCAGGAAGGGCTGTGGGCTGCCACCCAGGTCTCCAAGAACAACCCACCCACG GGACCTACTACCCAGAAGGA

TTACCTGGAAGTCATGACCCAAGTTCACGAAGAG GGCTTCGAGCTGGGCACCTTGGCTGGCCCGGCTTTTGCACGGCTGAGGAAATCCATTGGCCTGAC

TGAAGAGGACTACCAGGCTACTCTTGGCCCTGGTGATCCCTACCTTCAATTCTTCAGCACCTCCAAAAGCAAGGCCAGCTTCTTCCTGAC CCACGACCA

GCGCTTCTTTGTGAAGACCCAACGGCGCCACGAAGTGCATGTGCTGCTTGCCCACCTGCCCCGCTATGTGGAGCACCTGCAGCAATACCCACACTCCCTG

CTGGCACGGTTGCTGG GCGTATACAGTCTGCGGGTAGCTCAGGGGAAAAAG AAGTACTTCATCATCATGCAGTGCATCTTCTACCCTACCAGCCGCAT

TTCTGAGAG GTATGACATCAAGGGCTGCAACATAAGCCGCTGGGTAGATCCAGCCCCTGAGGGCAGCCCCCTTGTCTTGGTGCTGAAGGACCTCAACTT

TCAAGAAAAGACCATGAGATTGG GAGCCCAGCGGAGCTGGTTCCTCCGGCAGATGGAGCTAGACACCGCCTTCCTGCGGGAGGTGAATGTACTGGATTA

CAGCCTCCTGGTGGCCATCCAGTTTCTCCACGAAGACGAGAAGGGCATTCACCACTCTGTCTTCAGCACATTCAA - UNI13050 - GTCCATACAAG

GTGTGTCGAAGTCGAAGGGAACGGGGGACCAGAACTGCCGGATGCTGCCCGACCTTCCCAATGCCCTCCATATCTTGGACGGGCCAGACCAACGCTATTT

TCTGGGCTTAGTGGATATGACTACCGTGTATGGGTTTCGCAAACGGCTGGAACATGTGTGGAAGATGGTACGCTATCCAGGCCAGAGCGTCTCCACTGTC

AGCCCGGCTCACTACGCCCGTCGCCTCTGTCGGTGGGCAGAGGTGCACACAGAATGACTCACGTGTCTGCCTTCTTCCCTTATGGACAATGCGCCGGCAA

CTATTCTGCAGCTGTACCCAGGGAGCTAGCCTGCAGTTCATCCTACCAGCCACCAGAGGGAAGCACCCTCATAACTAATGCTGTGAAGACTCAGCCCCAT

TCGGTGACGGTGCTGTACCCTGCATAGAGCAAGGACCCTGACCCCAACCCTTAGCTCATTTACTATTAAAAAATGTTGATATTCTCTTTTTACAGACCA
Translation
MATPSLRSHE IPAHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHELHRMTRMMQEGLWAATQVSKNNPPT GPTTQKDYLEVMTQVHEE GF

ELGTLAGPAFARLRKSIGLTEEDYQATLGPGDPYLQFFSTSKSKASFFLT THDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYPHSLLARLLG GVYSL

RVAQGKK KYFIIMQCIFYPTSRISER RYDIKGCNISRWVDPAPEGSPLVLVLKDLNFQEKTMRLG GAQRSWFLRQMELDTAFLREVNVLDYSLLVAI

QFLHEDEKGIHHSVFSTFK - UNI13050 - KSIQGVSKSKGTGDQNCRMLPDLPNALHILDGPDQRYFLGLVDMTTVYGFRKRLEHVWKMVRYPGQS

VSTVSPAHYARRLCRWAEVHTE
Transcript ENSMUST00000055304
Sequence
GGCCTCCGAGACACCGCCAAAGCCAGAGAAGCGGCACCTGGGGGCGATGGCCACACCAAGCCTTAGGTCCCACGAG ATCCCGGCCCACTCCCAGGAGGC

TGGAAACAAGTCCATTTCCTCAGGGAGCCGCCGCGGCCTTCTTTGGCACCTCCGAGCCAGGCAGTCTAGAGTTGGCCTGTTTGAGGTCGGTCCAGGACAT

GAGCTGCATAGAATGACACGAATGATGCAGGAAGGGCTGTGGGCTGCCACCCAGGTCTCCAAGAACAACCCACCCACG GGACCTACTACCCAGAAGGAT

TACCTGGAAGTCATGACCCAAGTTCACGAAGAG GGCTTCGAGCTGGGCACCTTGGCTGGCCCGGCTTTTGCACGGCTGAGGAAATCCATTGGCCTGACT

GAAGAGGACTACCAGGCTACTCTTGGCCCTGGTGATCCCTACCTTCAATTCTTCAGCACCTCCAAAAGCAAGGCCAGCTTCTTCCTGAC CCACGACCAG

CGCTTCTTTGTGAAGACCCAACGGCGCCACGAAGTGCATGTGCTGCTTGCCCACCTGCCCCGCTATGTGGAGCACCTGCAGCAATACCCACACTCCCTGC

TGGCACGGTTGCTGG GCGTATACAGTCTGCGGGTAGCTCAGGGGAAAAAG AAGTACTTCATCATCATGCAGTGCATCTTCTACCCTACCAGCCGCATT

TCTGAGAG GTATGACATCAAGGGCTGCAACATAAGCCGCTGGGTAGATCCAGCCCCTGAGGGCAGCCCCCTTGTCTTGGTGCTGAAGGACCTCAACTTT

CAAGAAAAGACCATGAGATTGG GAGCCCAGCGGAGCTGGTTCCTCCGGCAGATGGAGCTAGACACCGCCTTCCTGCGGGAGGTGAATGTACTGGATTAC

AGCCTCCTGGTGGCCATCCAGTTTCTCCACGAAGACGAGAAGGGCATTCACCACTCTGTCTTCAGCACATTCAA - UNI13050 - GTCCATACAAGG

TGTGTCGAAGTCGAAGGGAACGGGGGACCAGAACTGCCGGATGCTGCCCGACCTTCCCAATGCCCTCCATATCTTGGACGGGCCAGACCAACGCTATTTT

CTGGGCTTAGTGGATATGACTACCGTGTATGGGTTTCGCAAACGGCTGGAACATGTGTGGAAGATGGTACGCTATCCAGGCCAGAGCGTCTCCACTGTCA

GCCCGGCTCACTACGCCCGTCGCCTCTGTCGGTGGGCAGAGGTGCACACAGAATGACTCACGTGTCTGCCTTCTTCCCTTATGGACAATGCGCCGGCAAC

TATTCTGCAGCTGTACCCAGGGAGCTAGCCTGCAGTTCATCCTACCAGCCACCAGAGGGAAGCACCCTCATAACTAATGCTGTGAAGACTCAGCCCCATT

CGGTGACGGTGCTGTACCCTGCATAGAGCAAGGACCCTGACCCCAACCCTTAGCTCATTTACTATTAAAAAATGTTGATATTCTCTTTTTAC
Translation
MATPSLRSHE IPAHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHELHRMTRMMQEGLWAATQVSKNNPPT GPTTQKDYLEVMTQVHEE GF

ELGTLAGPAFARLRKSIGLTEEDYQATLGPGDPYLQFFSTSKSKASFFLT THDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYPHSLLARLLG GVYSL

RVAQGKK KYFIIMQCIFYPTSRISER RYDIKGCNISRWVDPAPEGSPLVLVLKDLNFQEKTMRLG GAQRSWFLRQMELDTAFLREVNVLDYSLLVAI

QFLHEDEKGIHHSVFSTFK - UNI13050 - KSIQGVSKSKGTGDQNCRMLPDLPNALHILDGPDQRYFLGLVDMTTVYGFRKRLEHVWKMVRYPGQS

VSTVSPAHYARRLCRWAEVHTE

For any suggestions or comments, please send an email to unitrap@crg.es