Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046942 (2410003J06Rik)
Chromosomal location
Chr X: 76868570 - 76916774 (-)
Description
melanoma antigen family B, 16 Gene [Source:MGI Symbol;Acc:MGI:3644898]
RefSeq_peptide
NP_001104785.1 NP_001107206.1 NP_082301.1 
UniGene
Mm.379207 
MGI
MGI:1919217 MGI:3644898 
Uniprot/SWISSPROT
Q9CWV4 
Uniprot/SPTREMBL
Q8C387 Q80V80 
Human Ortholog
ENSG00000189023 (MAGEB16)
Omim not available
UniTrap UNI26282
Vector Insertion
Chr X: 76887128 - 76916621
Public Clones 5SE305D02 (ggtc) IST14134H9 (tigm)
Private Clones OST126947 (lexicon) OST102620 (lexicon) OST51016 (lexicon) OST37055 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052283
Sequence
ATTCCTTGCAGTCCAGGCCGGTGTGCAAAGGTGCCTGTGTACCCTGAGGGGAAAAGCAGACCCAGGCCAGCCCTAGCGCTCTCAACTCAGAAACAACACG

ATCTCTGGTTTGAACTAGGAAGAAGCCCGCACAGACCCAGAAAGGCAAACACG - UNI26282 - ATTGTTACCTGAACTAAATTCCTTGACGTTGGC

GGAGAAAGATAATTTTCTTTCCAGTCATCAAACAG TGAGGTGTGGCCTTCAACTGGAAGCACTGAAGCCAGACAATTAGAGGGAAGATTCAAAGGAGGT

GCTCTCAGGATTTAAG TCACCATGTCTCAGTCTTCAGAAGAATGTGCAGCTGACCAAGGCCAGACCTGTGAAGAGACCCAGAAACTACAGGTTGCAGCA

GCCTCCATCGATGTTGAGGAGCCATGTTCCTCACCTCATCTTATGGCTACTAGTCTGAAGGACCAGACCAGTGAGGAGACCCAAGTCTCCAAGGATGTGG

AGGAACCATGTTCCTCTTCTCAACTTCTTATGGCTAGCGACCAGGATGATTCTGAAGATGAGACAGCCAGTACTTCCAGTGATCTTCAGCATCCCTATGA

CTCTTCAAGCGAGTCTACTGAGGATCTTGATGACCAAGAAGTGCAGGGTAGCCCAGTCATTCCACCAGATCAGTCAGATAGCACAGATTTACCTGTGATG

ACTGTAGATGGGAAAGTTGATTTCTTGGTGAATTACATGCTGTACAAGTATCAGGTGAAAGAGGTGATGAGTATGAATGATATAATGACACTCATTGTCA

GAGAGGATGAAGATCGTTTTCATGAAATCCTCATGAGAGCTTCTGAGCGCATGGAGATGGTCTTTGGGCTGGATGTGAAGGAAGTAGATCCTATCAACCA

TTGCTATGCTCTCTTTATCAAATTAGGTCTCACCTATGATGGGATGCGCAATGATGAGTACAGCTTTCCTAAAACTGGTCTCCTGATACTCATCCTGGGT

GTAGTCTTTATGAAGGGCAACCGTGCCACTGAAGAGGAGATTTGGGAAGTATTGAATCCAATGGGAATCTATGCTGGGATGACTCATTTCATGTTTGGTG

ACCCTAGAGAGCTGATAACTGATGAGTTTGTGAGGGAGCAATACCTGGAATACCAGCCAATAGCCAATAGTGATCCCATACAGTATGAATATGTGTGGGG

GCTACGGGCTAAAGCTGAAACTAGTAAGATGAGAGTGTTAGAGTTTGTGGCCAAGGTTCATGGGTCAGACCCTACTGTGTTCCTTTCTCAGTATGAAGAG

GCACTGATTGAAGAAGAAGAGAGAACCCTTACCATGCTATTAGAGCATGCTGATTCAAGTTCTACTTCTGGTGAAAGTTCTAGTGACACAAGCAGCAACT

TCTCTCAGGTCTAGTACAGTCAGAGATCAGTTCCTTCTGTATAATTTACAGAGAATTTTTAAACTTGCGGGGAAAGATGTACGACCTAGATTGTATAGGG

AGAAGGGAGCGTCTTAGCTGCATAGTTCTAATTTGTATAAGCACCATGCCATGTTTTTCATTGTTTGCCCTTTATATATGAAAATACTTACACTTAAAAG

CATTGTTGTTTAGTTTCAAAATCTCAACTTAATACCATTCACAAATTTAATAAGAGCGTTGTCATAACATAAAACTAATTGGGAAATAATCCCATCTATC

TGTACAGTTATCTGGAATAGTAAAACATGCGTTTTCTAAGCTTCTACCTTTTAAACAGCTTTCTTCTAATTACTCCCTTTGTACCTTTCCATTTCTCAGT

AAAATTACATGCTCTATGTGGAGTTGTTTACTTTATAGTTGCCAATAAAATTCAAGAAAGTTTGCCTCAA
Translation
 - UNI26282 -   MSQSSEECAADQGQTCEETQKLQVAAASIDVEEPCSSPHLMATSLKDQTSEETQVSKDVEEPCSSSQLLMASDQDDSEDETAST

SSDLQHPYDSSSESTEDLDDQEVQGSPVIPPDQSDSTDLPVMTVDGKVDFLVNYMLYKYQVKEVMSMNDIMTLIVREDEDRFHEILMRASERMEMVFGLD

VKEVDPINHCYALFIKLGLTYDGMRNDEYSFPKTGLLILILGVVFMKGNRATEEEIWEVLNPMGIYAGMTHFMFGDPRELITDEFVREQYLEYQPIANSD

PIQYEYVWGLRAKAETSKMRVLEFVAKVHGSDPTVFLSQYEEALIEEEERTLTMLLEHADSSSTSGESSSDTSSNFSQV
Transcript ENSMUST00000101408
Sequence
ATGTCTCAGTCTTCAGAAGAATGTGCAGCTGACCAAGGCCAGACCTGTGAAGAGACCCAGAAACTACAGGTTGCAGCAGCCTCCATCGATGTTGAGGAGC

CATGTTCCTCACCTCATCTTATGGCTACTAGTCTGAAGGACCAGACCAGTGAGGAGACCCAAGTCTCCAAGGATGTGGAGGAACCATGTTCCTCTTCTCA

ACTTCTTATGGCTAGCGACCAGGATGATTCTGAAGATGAGACAGCCAGTACTTCCAGTGATCTTCAGCATCCCTATGACTCTTCAAGCGAGTCTACTGAG

GATCTTGATGACCAAGAAGTGCAGGGTAGCCCAGTCATTCCACCAGATCAGTCAGATAGCACAGATTTACCTGTGATGACTGTAGATGGGAAAGTTGATT

TCTTGGTGAATTACATGCTGTACAAGTATCAGGTGAAAGAGGTGATGAGTATGAATGATATAATGACACTCATTGTCAGAGAGGATGAAGATCGTTTTCA

TGAAATCCTCATGAGAGCTTCTGAGCGCATGGAGATGGTCTTTGGGCTGGATGTGAAGGAA GTCTCACCTATGATGGGATGCGCAATGATGAGTACAGC

TTTCCTAAAACTGGTCTCCTGA
Translation
MSQSSEECAADQGQTCEETQKLQVAAASIDVEEPCSSPHLMATSLKDQTSEETQVSKDVEEPCSSSQLLMASDQDDSEDETASTSSDLQHPYDSSSESTE

DLDDQEVQGSPVIPPDQSDSTDLPVMTVDGKVDFLVNYMLYKYQVKEVMSMNDIMTLIVREDEDRFHEILMRASERMEMVFGLDVKE VSPMMGCAMMST

AFLKLVS
Transcript ENSMUST00000114016
Sequence
GAAGACCTTGTTGAAAAGCCGCTGAAGCTGGTTTACCGAAAAGTTGAAAGAGAGAATTGTCTCAG TGAGGTGTGGCCTTCAACTGGAAGCACTGAAGCC

AGACAATTAGAGGGAAGATTCAAAGGAGGTGCTCTCAGGATTTAAG TCACCATGTCTCAGTCTTCAGAAGAATGTGCAGCTGACCAAGGCCAGACCTGT

GAAGAGACCCAGAAACTACAGGTTGCAGCAGCCTCCATCGATGTTGAGGAGCCATGTTCCTCACCTCATCTTATGGCTACTAGTCTGAAGGACCAGACCA

GTGAGGAGACCCAAGTCTCCAAGGATGTGGAGGAACCATGTTCCTCTTCTCAACTTCTTATGGCTAGCGACCAGGATGATTCTGAAGATGAGACAGCCAG

TACTTCCAGTGATCTTCAGCATCCCTATGACTCTTCAAGCGAGTCTACTGAGGATCTTGATGACCAAGAAGTGCAGGGTAGCCCAGTCATTCCACCAGAT

CAGTCAGATAGCACAGATTTACCTGTGATGACTGTAGATGGGAAAGTTGATTTCTTGGTGAATTACATGCTGTACAAGTATCAGGTGAAAGAGGTGATGA

GTATGAATGATATAATGACACTCATTGTCAGAGAGGATGAAGATCGTTTTCATGAAATCCTCATGAGAGCTTCTGAGCGCATGGAGATGGTCTTTGGGCT

GGATGTGAAGGAAGTAGATCCTATCAACCATTGCTATGCTCTCTTTATCAAATTAGGTCTCACCTATGATGGGATGCGCAATGATGAGTACAGCTTTCCT

AAAACTGGTCTCCTGATACTCATCCTGGGTGTAGTCTTTATGAAGGGCAACCGTGCCACTGAAGAGGAGATTTGGGAAGTATTGAATCCAATGGGAATCT

ATGCTGGGATGACTCATTTCATGTTTGGTGACCCTAGAGAGCTGATAACTGATGAGTTTGTGAGGGAGCAATACCTGGAATACCAGCCAATAGCCAATAG

TGATCCCATACAGTATGAATATGTGTGGGGGCTACGGGCTAAAGCTGAAACTAGTAAGATGAGAGTGTTAGAGTTTGTGGCCAAGGTTCATGGGTCAGAC

CCTACTGTGTTCCTTTCTCAGTATGAAGAGGCACTGATTGAAGAAGAAGAGAGAACCCTTACCATGCTATTAGAGCATGCTGATTCAAGTTCTACTTCTG

GTGAAAGTTCTAGTGACACAAGCAGCAACTTCTCTCAGGTCTAGTACAGTCAGAGATCAGTTCCTTCTGTATAATTTACAGAGAATTTTTAAACTTGCGG

GGAAAGATGTACGACCTAGATTGTATAGGGAGAAGGGAGCGTCTTAGCTGCATAGTTCTAATTTGTATAAGCACCATGCCATGTTTTTCATTGTTTGCCC

TTTATATATGAAAATACTTACACTTAAAAGCATTGTTGTTTAGTTTCAAAATCTCAACTTAATACCATTCACAAATTTAATAAGAGCGTTGTCATAACAT

AAAACTAATTGGGAAATAATCCCATCTATCTGTACAGTTATCTGGAATAGTAAAACATGCGTTTTCTAAGCTTCTACCTTTTAAACAGCTTTCTTCTAAT

TACTCCCTTTGTACCTTTCCATTTCTCAGTAAAATTACATGCTCTATGTGGAGTTGTTTACTTTATAGTTGCCAATAAAATTCAAGAAAGTTTGCCTC
Translation
  MSQSSEECAADQGQTCEETQKLQVAAASIDVEEPCSSPHLMATSLKDQTSEETQVSKDVEEPCSSSQLLMASDQDDSEDETASTSSDLQHPYDSSSES

TEDLDDQEVQGSPVIPPDQSDSTDLPVMTVDGKVDFLVNYMLYKYQVKEVMSMNDIMTLIVREDEDRFHEILMRASERMEMVFGLDVKEVDPINHCYALF

IKLGLTYDGMRNDEYSFPKTGLLILILGVVFMKGNRATEEEIWEVLNPMGIYAGMTHFMFGDPRELITDEFVREQYLEYQPIANSDPIQYEYVWGLRAKA

ETSKMRVLEFVAKVHGSDPTVFLSQYEEALIEEEERTLTMLLEHADSSSTSGESSSDTSSNFSQV

For any suggestions or comments, please send an email to unitrap@crg.es