Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046962 (Zfp295)
Chromosomal location
Chr 16: 98168599 - 98183786 (-)
Description
zinc finger protein 295 Gene [Source:MGI Symbol;Acc:MGI:1927240]
RefSeq_dna
NM_001081684 NM_001081685 NM_175428 
RefSeq_peptide
NP_001075153.1 NP_001075154.1 NP_780637.2 
UniGene
Mm.418352 Mm.458750 
MGI
MGI:1927240 
Uniprot/SPTREMBL
Q3UM76 Q8BSP5 Q8CDB1 Q8R0A4 Q6ZPV6 Q8CC25 
Human Ortholog
ENSG00000173276 (ZNF295)
Omim not available
UniTrap UNI26143
Vector Insertion
Chr 16: 98178066 - 98183578
Public Clones (sanger)
Private Clones OST134693 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2902
Vector Insertion
Chr 16: 98174259 - 98177922
Public Clones AD0631 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4689
Vector Insertion
Chr 16: 98172634 - 98174259
Public Clones AD0435 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063605
Sequence
GACGTCAAATTCAAGATGGATGGAATCACAGCGGCAGTGGAGGCTGCGGGTTGCGCGAGCCGAGTGTGAGCGGAAAGGGGCTTGGCGCCTGCCCCAGGGC

TGAAGAGCGGTGAGTAACCGTCACGCTCCGCGCCCTAGGAGGACGTCGGGCCCGGTCGGGGACTACGGCCTCTCCGCAAAACGCGGCCTTTCCTGACGTA

ACTCTGAG - UNI2902 - - UNI4689 - - UNI26143 - ATAAAGTGCAGGATGGAGGGACTGCTGCATTACATCAACCCAGCACATGCTATC

TCTCTGCTCAGTGCCCTCAATGAGGAGCGCCTCAAGGGACAGCTGTGTGACGTGCTCCTGATTGTTGGGGACCAGAAATTCCGAGCTCATAAGAACGTCT

TGGCTGCCAGCAGTGAGTACTTCCAGAGTTTATTCACGAATAAGGAGAACGAGGCACAGACTGTCTTTCAGCTGGACTTCTGTGAGCCTGACGCTTTTGA

CAACGTTCTGAACTACATTTACTCTTCTTCCCTTTTTGTGGAGAAGGGCAGCCTTGCTGCTGTGCAGGAGCTGGGGTATAGCCTTGGTATCTCCTTCCTG

ACCAACATCGTTGCCAAAGCCCCTCAGGCTCCTTTTCCAGCCTGTCCCAACAGGAAAAGAGTGCCAGTGGAAGATGATGAAACCAGCTCTCAAAAGCGAA

GTGTCATTGTGTGTCAGGGCAGAAGTGAAGTGCCAGGGAAAGCCAGTGGTCCAGCCATGCAGGACCTCAGCCATACTGCCCGGGCCTCCCCCAGTGCTTC

AGTCAAGACCACCATCAGTAAGCCACATGTGGCCAAGCCGCCAGAGCAGCTTCATAGTCTGCCCTTAACTGAAAAGAGCTGGACAAAGGATAGTGCTGCA

GTATATGCAAAGTCTCTGGAACAGGCTGGGGCTTTGGATGATCCTAATAGGGGCAGTTTGGTAAAGAGAAATACAGTCCTGCCCCCAAAGCCTTCACAGG

ACAGGGAGGCCACAGATGATAAACCAGGGGTGAGCAGCCAGCTTCCCAAGGGGAAAGCTATAGAGCTGGCTCTGAAGAGACCACGGCCCCCTGTTCTGTC

TCTTCATAGCTCATCAGAGACTCCATATCTCCTAAAAGAAACTAGCAAAGGAGGCGGTCAGGGAGAGGATAGGAACTTGCTCTACTACTCTAAGCTAGGG

CTGGTGGTCCCTTCTGGTGGGCCTGCTTCTGCAAACCAGAGCATTGACAGAAGTGGCCCACTAGTGAAAAGCCTCCTCAGGCGGTCACTGTCTATGGACA

GCCAGGTTCCTGTTTACTCCCCCTCCATAGATTTGAAGTCATCCCAGGGATCATCCACAGCGGCAAATGAGGCACCGGGTAGTGTGTTCTGTTCGATGTC

TCAAAAGTCATCTTTAAAAGATTGCAGTGAAAAAAAAGCTCTGGATGACAGGCCTCAAGTGCTCCAGCCTCATCGCCTCAGGTCCTTTAGTGCTTCCCAG

TCAACAGACAGGGAGGAAGCCTCCCCTGTGACTGAGGTACGCATTAAGACGGAACCCAGCAGCCCACTGTCAGACCCCTCAGACATCATCCGGGTCACTG

TGGGAGGAGACGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCTACGAGAGACCTGCCCCTCAAAACAGAGGAAGACCAGAGAGATATGAG

CAGACTCCCAGCAAAGAGAAGGTTCCAGACAGACAGAAGGTCACCCTTGAAGAAGGCAAAGGCAAATGAACACGGGCCTGCTGTCTCAGAAGAGAACTGT

GAAGAGGGCAGGAGCCCTCCTTCCCTTGACAGCAACTTCCCAGATTCTGACTTAAACAGAGAGGAGTTTGGTGAGTTGGAGGGGACGAGACCAAACAAAA

AATTTAAATGCAAACATTGCCTTAAGATTTTTAGATCAACTGCGGGTCTTCACCGCCATGTTAACATGTACCATAACCCAGAGAAGCCTTACGCTTGTGA

CATCTGTCACAAGAGGTTTCACACCAACTTCAAAGTGTGGACACACTGTCAGACCCAACACGGCATAGTGAAGAACCCATCGCCAGCCTCTAGTTCCCAT

GCAGTTTTGGATGAGAAATTCCAAAGAAAGCTGATTGACATAGTGAGAGAGAGGGAGATTAAGAAGGCCCTGATCATTAAGCTGAGGCGCAGCAAGCCTG

GCTTCCAGGGACAGAGTAGCTCCCCAGCACAGCAAGTCATCAAGAGGAACTTGCGCTCCCGAGCCAAAGGGGCCTACATTTGTGCCTACTGTGGCAAGGC

ATACCGCTTTCTCTCTCAGTTTAAGCAGCACATAAAGATGCACCCAGGAGAGAGGCCCCTCGGAGTAAGCAGAGCTGCTAAGCCAAAAGAGCGGGCTCTG

GCACGCGCGGTAGAGAACAAGGAGGTTTACCCGTGCCGCCTCTGTAATGCTAAGCTCTCTTCTCTTCTAGAGCAAGGCAACCACGAGCGCTTGTGCCGGA

ACGCCACCGTTTGCCCTTACTGCAGCCTCAGGTTCTTCTCTCCCGCACTGAAGCAGGAACATGAGGACAGGTGTGAGTACAAAAAGCTGACTTGCCTGGA

GTGCATGCGCACCTTCAAGTCCTCCTTCAGCATCTGGCGGCACCAGGTAGAAGTGCATAACCAGAACAACATGGCTTTAGCAGAGAACTTCGCCCTGGCC

ACCCTGGACCACAACGGTGAAGTGGCAGCCGCTTCCAGGCCTCAGACTGAGCCCAGCAAGGTAAACCATGTGGCCACTCCAAAAGAGGATACAGCATTTA

GCGACTCTTCAGAGCAAGTGAACTTTGATTCTGAGGATTCCTCCTGCCTCCCTGAAGACTTGAGTCTTTCAAAGCAACTGAAAGTCCAAGTCAAAGAGGA

GCCTGTGGAGGAGGCAGAGGAGGAGGCTCCTGAGGCTAGTGCAGCTCCCAGGGAGGCTGGCCCCAGCAAGGAGACCGGCCTATGGCCCTGTGAGAAATGC

GGAAAGATGTTCACGGCACACAAGCAGCTGGAGCGGCACCAGGAGCTGCTGTGTTCTGTGAAGCCCTTCATCTGCCACGTATGCTACAAAGCCTTCCGTA

CCAACTTCCGACTCTGGAGTCACTTCCAGACCCACATGTCTCAGGCTACAGAGGAGCCTGTGCAGAAAGAATCAGAGGTGTGTCCTGTGCCCACAAACTC

CCCCTCCCCACCACCTCTGCCACCTCCGCCACCCTTGCCCAAGATTCAGCCCCTGGAGCCAGACAGCCCCACAGGCCTGCCTGAGAACCCAACCCCAGCT

ACAGAGAAGCTGTTTGCACCCCAGGAGTCAGATACCCTCTTCTACCACGCCCCACCCCTTTCAGCAATCACATTTAAAAGACAGTTCATGTGCAAGCTCT

GCCATAGGACATTCAAGACGGCCTTCAGTCTTTGGAGTCATGAGCAGACACACAATTAAAGGACCTACCCCTTTCACCTATCACAAAGTAGCAGGCCCTT

GGCTTGTAAACTGTGTCCTAAGACAGAATATTTGAAAAAATAATAATAATAAAGGTTGGAAATTATTATGTTTGAATTTTAAGTTTGGGATGAATTAATA

CTGGCTAGAAATGACCTCACAGCTTTCTGGACCTCAGCAGCAGGGGTTTGATTCTATTACTATTGAAGTTGGACTAATGTTGGTGATTGAGGTTTTTGGT

TTCTGAGTAGTGGGATGCTTGGGAAGTGGGTTTTTTGTTTGTTTGGTTGGTTGGTTTTGGTTTTTTTTTGTTGTTGGTTTTGTTTTGTTTTTGATTATTG

CAGACACCTAAATTTGAGGTAACCTTTAGCCATGTTTCTAAGGCCAAAAAAACATACAAGGAAGAAGGGGAGTCATTTGCAGTATTGAGTCAGATTTTAG

ACTACTTTAGCAATAAGAAAAGGCAAGCCCCAACTTTAGTAAAGTATCCTAACACTTGATAAGAAAAAAACTTGGTATTTTGTGGTCCTATAAAACTTCC

TTTTTGTATGAAAATTGTGAGACTTTAAATCAGCAATAGTCACACTTAGATTTTTTTTAATAAAAGAACAATCTGTCAATTACATCATACAATCAGTGAT

GGTCTGTTCTAAGGGAGGCAGAGCAATAGAAGCGTGTTTGTGGGGTCCTCTACAGTCAGCTGCAACAGCTTAGTTGTGAAAGCCGCTAAAGTCTGTGGTG

TGTTCATAGCATGGCTTTCAACTGGGGCTTTAGAACTGACAATGTCTGCTCTCTGTCAGCTTGAAACTCGGGTGTCATTGAGATAAGCAGTGCTAGCATG

AGGTTAGCAGAGCATAGCCTTACCACATCCTAGACCACCATTCTCTCTCTAGAGGCTTCAGAGATTGGAGGAAATGCCGTGTTGCAGTTTCCATGTGCTT

TCCAAGAACTGTACACACAACATAGACATTTCCTGCCTGTCTTTTGTGAGTACTTCTGTGGGGTTATTGGAGTGGACAGCAGTGGAAATGTCACTACATG

ATATGCAAGCGTGGATTAAAGCACTAGCAAGAGGCCAAAATTAGTTTTTGCTACTTGATTTGGTACCTTAGGGTTTGGGCTCCTCTGGTTTTTTCTTGTT

TTTTTGTTTGTTTGTTTGTTTGTTTTTTTGTTTTTTTTTTTTTTTTTTTTTTGCTTTTTGGTTTGTTCCTTGCAGGTTATAATTAAATCTCTCCATAGGC

AGAATCCAAAGTTCAGTGAAATATTTCAAAAGACAAAGGGAAGATCACTCCTGGAAAGGAAATTAGGGGGATGCAAATTCCCTATTCACTTTTGCTACAA

GCTGTTTCTTCACATTTTCAAGGTGTGATCTAACAGAGACACTGGCCCATCTGCTCACCAGCATTCTACACCCATGGTAGCAAAGGCAATCTTGATATTG

AAACTTTTTTTTTAATAAATTACTAATTGACTTTGTATATTATAGAAGCTATATGTGGAATTTTGCCTTTTATCTTTTCACTTGAAAAAGCAATCAGAAA

TCCCTAAATATGTCTGCATTTCCTATTTTGTTTCTTAAATTTTGCAAAGAAGGGAAATAAAATTAGGTTGCAGTTATTAATTCTTGCCATCTGCTTTCTT

AAACTATGCATTTTAGAGATGAAACTAAAAGTGTCCACCATGTGATGAATGAAGCTAGTGCCAGGCTAGGTAGCTGTCCACTGAACTTCTTCCCTGTGGT

GAGTGAATGGTCTCTCCTCAGAGTGTTACTTCTTTTAAGACCATCTCTCTGCATGGTCATCTCCTGTGTAGTTACAGAGTGATAACCTCCAGACCTGGCA

TTGCCAGCTCCTGCCCCAACACTTGAACCTGTGCTACGTTTTTGAAGATTTATAAAGTAACATTGTTGCAAAAAAAAAAAATGTATTTTTGATCTAAATA

CAGGTTCTGCATATCTGTTAGGTTTTACAAATTACCAGTGTTTGTCACCTTTTTTTGTCTAGGAAGAAAACATAAGATTTCAAATAAATTTTTGAACCAA

AAACATTTATAATGCAGTTGTGGTTTTTCTATTGCTTTTTATACTGTATCTTGAAAGACATCGGGCTGCAAGAATTTATTTTGATGTCAAACTCTATCCT

TCCATTCATGTAACTATTTCAAATGCTAAGAAACTAATAAAAAACAGTAATCACTTTTTGCAGTAAACAGTTTTTTAGAGAATGTTTATCTCAGCTAGCA

GGCAGATGTTTAGTGAAATAAATAGGTCTTTCACCACTGTAAATCTTTAGATAGTAGAGATATTCTTGTAAATGTTTTTCTAATTGTACTAATTTTTACA

AGTATAGAAAGCTCATTGTTTTTTGTAATTATTTAAGATGCCTGCTTTTTTATGCAGTTGTGGAAAGAATGTAAACTTTTAATATATTCTTTGTTAACCT

GCAAAC
Translation
 - UNI2902 - - UNI4689 - - UNI26143 - MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNK

ENEAQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKGSLAAVQELGYSLGISFLTNIVAKAPQAPFPACPNRKRVPVEDDETSSQKRSVIVCQGRSEVPGKA

SGPAMQDLSHTARASPSASVKTTISKPHVAKPPEQLHSLPLTEKSWTKDSAAVYAKSLEQAGALDDPNRGSLVKRNTVLPPKPSQDREATDDKPGVSSQL

PKGKAIELALKRPRPPVLSLHSSSETPYLLKETSKGGGQGEDRNLLYYSKLGLVVPSGGPASANQSIDRSGPLVKSLLRRSLSMDSQVPVYSPSIDLKSS

QGSSTAANEAPGSVFCSMSQKSSLKDCSEKKALDDRPQVLQPHRLRSFSASQSTDREEASPVTEVRIKTEPSSPLSDPSDIIRVTVGGDAAAAAVAAAAA

AAATRDLPLKTEEDQRDMSRLPAKRRFQTDRRSPLKKAKANEHGPAVSEENCEEGRSPPSLDSNFPDSDLNREEFGELEGTRPNKKFKCKHCLKIFRSTA

GLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRSKPGFQGQSSSPAQQVIK

RNLRSRAKGAYICAYCGKAYRFLSQFKQHIKMHPGERPLGVSRAAKPKERALARAVENKEVYPCRLCNAKLSSLLEQGNHERLCRNATVCPYCSLRFFSP

ALKQEHEDRCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMALAENFALATLDHNGEVAAASRPQTEPSKVNHVATPKEDTAFSDSSEQVNFDSEDSS

CLPEDLSLSKQLKVQVKEEPVEEAEEEAPEASAAPREAGPSKETGLWPCEKCGKMFTAHKQLERHQELLCSVKPFICHVCYKAFRTNFRLWSHFQTHMSQ

ATEEPVQKESEVCPVPTNSPSPPPLPPPPPLPKIQPLEPDSPTGLPENPTPATEKLFAPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHE

QTHN
Transcript ENSMUST00000052089
Sequence
GACGTCAAATTCAAGATGGATGGAATCACAGCGGCAGTGGAGGCTGCGGGTTGCGCGAGCCGAGTGTGAGCGGAAAGGGGCTTGGCGCCTGCCCCAGGGC

TGAAGAGCGGTGAGTAACCGTCACGCTCCGCGCCCTAGGAGGACGTCGGGCCCGGTCGGGGACTACGGCCTCTCCGCAAAACGCGGCCTTTCCTGACGTA

ACTCTGAG - UNI26143 - TCACAGGAATGTGAGGTGCAGGAGAACAGGAAGCCAGCCAACGAGCTCACCTCCCACCATCAGCACCTCTTATGATGC

ACAGTGTACAGCGGGCTCACAAACACTCGGGAGAGGAAGAGAGAAGAAAGATGTGTGCTTGCCAG - UNI2902 - - UNI4689 - ATAAAGTGCA

GGATGGAGGGACTGCTGCATTACATCAACCCAGCACATGCTATCTCTCTGCTCAGTGCCCTCAATGAGGAGCGCCTCAAGGGACAGCTGTGTGACGTGCT

CCTGATTGTTGGGGACCAGAAATTCCGAGCTCATAAGAACGTCTTGGCTGCCAGCAGTGAGTACTTCCAGAGTTTATTCACGAATAAGGAGAACGAGGCA

CAGACTGTCTTTCAGCTGGACTTCTGTGAGCCTGACGCTTTTGACAACGTTCTGAACTACATTTACTCTTCTTCCCTTTTTGTGGAGAAGGGCAGCCTTG

CTGCTGTGCAGGAGCTGGGGTATAGCCTTGGTATCTCCTTCCTGACCAACATCGTTGCCAAAGCCCCTCAGGCTCCTTTTCCAGCCTGTCCCAACAGGAA

AAGAGTGCCAGTGGAAGATGATGAAACCAGCTCTCAAAAGCGAAGTGTCATTGTGTGTCAGGGCAGAAGTGAAGTGCCAGGGAAAGCCAGTGGTCCAGCC

ATGCAGGACCTCAGCCATACTGCCCGGGCCTCCCCCAGTGCTTCAGTCAAGACCACCATCAGTAAGCCACATGTGGCCAAGCCGCCAGAGCAGCTTCATA

GTCTGCCCTTAACTGAAAAGAGCTGGACAAAGGATAGTGCTGCAGTATATGCAAAGTCTCTGGAACAGGCTGGGGCTTTGGATGATCCTAATAGGGGCAG

TTTGGTAAAGAGAAATACAGTCCTGCCCCCAAAGCCTTCACAGGACAGGGAGGCCACAGATGATAAACCAGGGGTGAGCAGCCAGCTTCCCAAGGGGAAA

GCTATAGAGCTGGCTCTGAAGAGACCACGGCCCCCTGTTCTGTCTCTTCATAGCTCATCAGAGACTCCATATCTCCTAAAAGAAACTAGCAAAGGAGGCG

GTCAGGGAGAGGATAGGAACTTGCTCTACTACTCTAAGCTAGGGCTGGTGGTCCCTTCTGGTGGGCCTGCTTCTGCAAACCAGAGCATTGACAGAAGTGG

CCCACTAGTGAAAAGCCTCCTCAGGCGGTCACTGTCTATGGACAGCCAGGTTCCTGTTTACTCCCCCTCCATAGATTTGAAGTCATCCCAGGGATCATCC

ACAGCGGCAAATGAGGCACCGGGTAGTGTGTTCTGTTCGATGTCTCAAAAGTCATCTTTAAAAGATTGCAGTGAAAAAAAAGCTCTGGATGACAGGCCTC

AAGTGCTCCAGCCTCATCGCCTCAGGTCCTTTAGTGCTTCCCAGTCAACAGACAGGGAGGAAGCCTCCCCTGTGACTGAGGTACGCATTAAGACGGAACC

CAGCAGCCCACTGTCAGACCCCTCAGACATCATCCGGGTCACTGTGGGAGGAGACGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCTACG

AGAGACCTGCCCCTCAAAACAGAGGAAGACCAGAGAGATATGAGCAGACTCCCAGCAAAGAGAAGGTTCCAGACAGACAGAAGGTCACCCTTGAAGAAGG

CAAAGGCAAATGAACACGGGCCTGCTGTCTCAGAAGAGAACTGTGAAGAGGGCAGGAGCCCTCCTTCCCTTGACAGCAACTTCCCAGATTCTGACTTAAA

CAGAGAGGAGTTTG - UNI4689 - AGCAAGGCAACCACGAGCGCTTGTGCCGGAACGCCACCGTTTGCCCTTACTGCAGCCTCAGGTTCTTCTCTCC

CGCACTGAAGCAGGAACATGAGGACAGGTGTGAGTACAAAAAGCTGACTTGCCTGGAGTGCATGCGCACCTTCAAGTCCTCCTTCAGCATCTGGCGGCAC

CAGGTAGAAGTGCATAACCAGAACAACATGGCTTTAGCAGAGAACTTCGCCCTGGCCACCCTGGACCACAACGGTGAAGTGGCAGCCGCTTCCAGGCCTC

AGACTGAGCCCAGCAAGGTAAACCATGTGGCCACTCCAAAAGAGGATACAGCATTTAGCGACTCTTCAGAGCAAGTGAACTTTGATTCTGAGGATTCCTC

CTGCCTCCCTGAAGACTTGAGTCTTTCAAAGCAACTGAAAGTCCAAGTCAAAGAGGAGCCTGTGGAGGAGGCAGAGGAGGAGGCTCCTGAGGCTAGTGCA

GCTCCCAGGGAGGCTGGCCCCAGCAAGGAGACCGGCCTATGGCCCTGTGAGAAATGCGGAAAGATGTTCACGGCACACAAGCAGCTGGAGCGGCACCAGG

AGCTGCTGTGTTCTGTGAAGCCCTTCATCTGCCACGTATGCTACAAAGCCTTCCGTACCAACTTCCGACTCTGGAGTCACTTCCAGACCCACATGTCTCA

GGCTACAGAGGAGCCTGTGCAGAAAGAATCAGAGGTGTGTCCTGTGCCCACAAACTCCCCCTCCCCACCACCTCTGCCACCTCCGCCACCCTTGCCCAAG

ATTCAGCCCCTGGAGCCAGACAGCCCCACAGGCCTGCCTGAGAACCCAACCCCAGCTACAGAGAAGCTGTTTGCACCCCAGGAGTCAGATACCCTCTTCT

ACCACGCCCCACCCCTTTCAGCAATCACATTTAAAAGACAGTTCATGTGCAAGCTCTGCCATAGGACATTCAAGACGGCCTTCAGTCTTTGGAGTCATGA

GCAGACACACAATTAAAGGACCTACCCCTTTCACCTATCACAAAGTAGCAGGCCCTTGGCTTGTAAACTGTGTCCTAAGACAGAATATTTGAAAAAATAA

TAATAATAAAGGTTGGAAATTATTATGTTTGAATTTTAAGTTTGGGATGAATTAATACTGGCTAGAAATGACCTCACAGCTTTCTGGACCTCAGCAGCAG

GGGTTTGATTCTATTACTATTGAAGTTGGACTAATGTTGGTGATTGAGGTTTTTGGTTTCTGAGTAGTGGGATGCTTGGGAAGTGGGTTTTTTGTTTGTT

TGGTTGGTTGGTTTTGGTTTTTTTTTGTTGTTGGTTTTGTTTTGTTTTTGATTATTGCAGACACCTAAATTTGAGGTAACCTTTAGCCATGTTTCTAAGG

CCAAAAAAACATACAAGGAAGAAGGGGAGTCATTTGCAGTATTGAGTCAGATTTTAGACTACTTTAGCAATAAGAAAAGGCAAGCCCCAACTTTAGTAAA

GTATCCTAACACTTGATAAGAAAAAAACTTGGTATTTTGTGGTCCTATAAAACTTCCTTTTTGTATGAAAATTGTGAGACTTTAAATCAGCAATAGTCAC

ACTTAGATTTTTTTTAATAAAAGAACAATCTGTCAATTACATCATACAATCAGTGATGGTCTGTTCTAAGGGAGGCAGAGCAATAGAAGCGTGTTTGTGG

GGTCCTCTACAGTCAGCTGCAACAGCTTAGTTGTGAAAGCCGCTAAAGTCTGTGGTGTGTTCATAGCATGGCTTTCAACTGGGGCTTTAGAACTGACAAT

GTCTGCTCTCTGTCAGCTTGAAACTCGGGTGTCATTGAGATAAGCAGTGCTAGCATGAGGTTAGCAGAGCATAGCCTTACCACATCCTAGACCACCATTC

TCTCTCTAGAGGCTTCAGAGATTGGAGGAAATGCCGTGTTGCAGTTTCCATGTGCTTTCCAAGAACTGTACACACAACATAGACATTTCCTGCCTGTCTT

TTGTGAGTACTTCTGTGGGGTTATTGGAGTGGACAGCAGTGGAAATGTCACTACATGATATGCAAGCGTGGATTAAAGCACTAGCAAGAGGCCAAAATTA

GTTTTTGCTACTTGATTTGGTACCTTAGGGTTTGGGCTCCTCTGGTTTTTTCTTGTTTTTTTGTTTGTTTGTTTGTTTGTTTTTTTGTTTTTTTTTTTTT

TTTTTTTTTGCTTTTTGGTTTGTTCCTTGCAGGTTATAATTAAATCTCTCCATAGGCAGAATCCAAAGTTCAGTGAAATATTTCAAAAGACAAAGGGAAG

ATCACTCCTGGAAAGGAAATTAGGGGGATGCAAATTCCCTATTCACTTTTGCTACAAGCTGTTTCTTCACATTTTCAAGGTGTGATCTAACAGAGACACT

GGCCCATCTGCTCACCAGCATTCTACACCCATGGTAGCAAAGGCAATCTTGATATTGAAACTTTTTTTTTAATAAATTACTAATTGACTTTGTATATTAT

AGAAGCTATATGTGGAATTTTGCCTTTTATCTTTTCACTTGAAAAAGCAATCAGAAATCCCTAAATATGTCTGCATTTCCTATTTTGTTTCTTAAATTTT

GCAAAGAAGGGAAATAAAATTAGGTTGCAGTTATTAATTCTTGCCATCTGCTTTCTTAAACTATGCATTTTAGAGATGAAACTAAAAGTGTCCACCATGT

GATGAATGAAGCTAGTGCCAGGCTAGGTAGCTGTCCACTGAACTTCTTCCCTGTGGTGAGTGAATGGTCTCTCCTCAGAGTGTTACTTCTTTTAAGACCA

TCTCTCTGCATGGTCATCTCCTGTGTAGTTACAGAGTGATAACCTCCAGACCTGGCATTGCCAGCTCCTGCCCCAACACTTGAACCTGTGCTACGTTTTT

GAAGATTTATAAAGTAACATTGTTGCAAAAAAAAAAAATGTATTTTTGATCTAAATACAGGTTCTGCATATCTGTTAGGTTTTACAAATTACCAGTGTTT

GTCACCTTTTTTTGTCTAGGAAGAAAACATAAGATTTCAAATAAATTTTTGAACCAAAAACATTTATAATGCAGTTGTGGTTTTTCTATTGCTTTTTATA

CTGTATCTTGAAAGACATCGGGCTGCAAGAATTTATTTTGATGTCAAACTCTATCCTTCCATTCATGTAACTATTTCAAATGCTAAGAAACTAATAAAAA

ACAGTAATCACTTTTTGCAGTAAACAGTTTTTTAGAGAATGTTTATCTCAGCTAGCAGGCAGATGTTTAGTGAAATAAATAGGTCTTTCACCACTGTAAA

TCTTTAGATAGTAGAGATATTCTTGTAAATGTTTTTCTAATTGTACTAATTTTTACAAGTATAGAAAGCTCATTGTTTTTTGTAATTATTTAAGATGCCT

GCTTTTTTATGCAGTTGTGGAAAGAATGTAAACTTTTAATATATTCTTTGTTAACCTGCAAAC
Translation
 - UNI26143 - MMHSVQRAHKHSGEEERRKMCACQ - UNI2902 - - UNI4689 - IKCRMEGLLHYINPAHAISLLSALNEERLKGQLCDVL

LIVGDQKFRAHKNVLAASSEYFQSLFTNKENEAQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKGSLAAVQELGYSLGISFLTNIVAKAPQAPFPACPNRK

RVPVEDDETSSQKRSVIVCQGRSEVPGKASGPAMQDLSHTARASPSASVKTTISKPHVAKPPEQLHSLPLTEKSWTKDSAAVYAKSLEQAGALDDPNRGS

LVKRNTVLPPKPSQDREATDDKPGVSSQLPKGKAIELALKRPRPPVLSLHSSSETPYLLKETSKGGGQGEDRNLLYYSKLGLVVPSGGPASANQSIDRSG

PLVKSLLRRSLSMDSQVPVYSPSIDLKSSQGSSTAANEAPGSVFCSMSQKSSLKDCSEKKALDDRPQVLQPHRLRSFSASQSTDREEASPVTEVRIKTEP

SSPLSDPSDIIRVTVGGDAAAAAVAAAAAAAATRDLPLKTEEDQRDMSRLPAKRRFQTDRRSPLKKAKANEHGPAVSEENCEEGRSPPSLDSNFPDSDLN

REEFE - UNI4689 - EQGNHERLCRNATVCPYCSLRFFSPALKQEHEDRCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMALAENFALATLDHN

GEVAAASRPQTEPSKVNHVATPKEDTAFSDSSEQVNFDSEDSSCLPEDLSLSKQLKVQVKEEPVEEAEEEAPEASAAPREAGPSKETGLWPCEKCGKMFT

AHKQLERHQELLCSVKPFICHVCYKAFRTNFRLWSHFQTHMSQATEEPVQKESEVCPVPTNSPSPPPLPPPPPLPKIQPLEPDSPTGLPENPTPATEKLF

APQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Transcript ENSMUST00000113734
Sequence
GACGTCAAATTCAAGATGGATGGAATCACAGCGGCAGTGGAGGCTGCGGGTTGCGCGAGCCGAGTGTGAGCGGAAAGGGGCTTGGCGCCTGCCCCAGGGC

TGAAGAGCGGTGAGTAACCGTCACGCTCCGCGCCCTAGGAGGACGTCGGGCCCGGTCGGGGACTACGGCCTCTCCGCAAAACGCGGCCTTTCCTGACGTA

ACTCTGAG - UNI26143 - TCACAGGAATGTGAGGTGCAGGAGAACAGGAAGCCAGCCAACGAGCTCACCTCCCACCATCAGCACCTCTTATGATGC

ACAGTGTACAGCGGGCTCACAAACACTCGGGAGAGGAAGAGAGAAGAAAGATGTGTGCTTGCCAG - UNI2902 - - UNI4689 - ATAAAGTGCA

GGATGGAGGGACTGCTGCATTACATCAACCCAGCACATGCTATCTCTCTGCTCAGTGCCCTCAATGAGGAGCGCCTCAAGGGACAGCTGTGTGACGTGCT

CCTGATTGTTGGGGACCAGAAATTCCGAGCTCATAAGAACGTCTTGGCTGCCAGCAGTGAGTACTTCCAGAGTTTATTCACGAATAAGGAGAACGAGGCA

CAGACTGTCTTTCAGCTGGACTTCTGTGAGCCTGACGCTTTTGACAACGTTCTGAACTACATTTACTCTTCTTCCCTTTTTGTGGAGAAGGGCAGCCTTG

CTGCTGTGCAGGAGCTGGGGTATAGCCTTGGTATCTCCTTCCTGACCAACATCGTTGCCAAAGCCCCTCAGGCTCCTTTTCCAGCCTGTCCCAACAGGAA

AAGAGTGCCAGTGGAAGATGATGAAACCAGCTCTCAAAAGCGAAGTGTCATTGTGTGTCAGGGCAGAAGTGAAGTGCCAGGGAAAGCCAGTGGTCCAGCC

ATGCAGGACCTCAGCCATACTGCCCGGGCCTCCCCCAGTGCTTCAGTCAAGACCACCATCAGTAAGCCACATGTGGCCAAGCCGCCAGAGCAGCTTCATA

GTCTGCCCTTAACTGAAAAGAGCTGGACAAAGGATAGTGCTGCAGTATATGCAAAGTCTCTGGAACAGGCTGGGGCTTTGGATGATCCTAATAGGGGCAG

TTTGGTAAAGAGAAATACAGTCCTGCCCCCAAAGCCTTCACAGGACAGGGAGGCCACAGATGATAAACCAGGGGTGAGCAGCCAGCTTCCCAAGGGGAAA

GCTATAGAGCTGGCTCTGAAGAGACCACGGCCCCCTGTTCTGTCTCTTCATAGCTCATCAGAGACTCCATATCTCCTAAAAGAAACTAGCAAAGGAGGCG

GTCAGGGAGAGGATAGGAACTTGCTCTACTACTCTAAGCTAGGGCTGGTGGTCCCTTCTGGTGGGCCTGCTTCTGCAAACCAGAGCATTGACAGAAGTGG

CCCACTAGTGAAAAGCCTCCTCAGGCGGTCACTGTCTATGGACAGCCAGGTTCCTGTTTACTCCCCCTCCATAGATTTGAAGTCATCCCAGGGATCATCC

ACAGCGGCAAATGAGGCACCGGGTAGTGTGTTCTGTTCGATGTCTCAAAAGTCATCTTTAAAAGATTGCAGTGAAAAAAAAGCTCTGGATGACAGGCCTC

AAGTGCTCCAGCCTCATCGCCTCAGGTCCTTTAGTGCTTCCCAGTCAACAGACAGGGAGGAAGCCTCCCCTGTGACTGAGGTACGCATTAAGACGGAACC

CAGCAGCCCACTGTCAGACCCCTCAGACATCATCCGGGTCACTGTGGGAGGAGACGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCTACG

AGAGACCTGCCCCTCAAAACAGAGGAAGACCAGAGAGATATGAGCAGACTCCCAGCAAAGAGAAGGTTCCAGACAGACAGAAGGTCACCCTTGAAGAAGG

CAAAGGCAAATGAACACGGGCCTGCTGTCTCAGAAGAGAACTGTGAAGAGGGCAGGAGCCCTCCTTCCCTTGACAGCAACTTCCCAGATTCTGACTTAAA

CAGAGAGGAGTTTGGTGAGTTGGAGGGGACGAGACCAAACAAAAAATTTAAATGCAAACATTGCCTTAAGATTTTTAGATCAACTGCGGGTCTTCACCGC

CATGTTAACATGTACCATAACCCAGAGAAGCCTTACGCTTGTGACATCTGTCACAAGAGGTTTCACACCAACTTCAAAGTGTGGACACACTGTCAGACCC

AACACGGCATAGTGAAGAACCCATCGCCAGCCTCTAGTTCCCATGCAGTTTTGGATGAGAAATTCCAAAGAAAGCTGATTGACATAGTGAGAGAGAGGGA

GATTAAGAAGGCCCTGATCATTAAGCTGAGGCGCAGCAAGCCTGGCTTCCAGGGACAGAGTAGCTCCCCAGCACAGCAAGTCATCAAGAGGAACTTGCGC

TCCCGAGCCAAAGGGGCCTACATTTGTGCCTACTGTGGCAAGGCATACCGCTTTCTCTCTCAGTTTAAGCAGCACATAAAGATGCACCCAGGAGAGAGGC

CCCTCGGAGTAAGCAGAGCTGCTAAGCCAAAAGAGCGGGCTCTGGCACGCGCGGTAGAGAACAAGGAGGTTTACCCGTGCCGCCTCTGTAATGCTAAGCT

CTCTTCTCTTCTAGAGCAAGGCAACCACGAGCGCTTGTGCCGGAACGCCACCGTTTGCCCTTACTGCAGCCTCAGGTTCTTCTCTCCCGCACTGAAGCAG

GAACATGAGGACAGGTGTGAGTACAAAAAGCTGACTTGCCTGGAGTGCATGCGCACCTTCAAGTCCTCCTTCAGCATCTGGCGGCACCAGGTAGAAGTGC

ATAACCAGAACAACATGGCTTTAGCAGAGAACTTCGCCCTGGCCACCCTGGACCACAACGGTGAAGTGGCAGCCGCTTCCAGGCCTCAGACTGAGCCCAG

CAAGGTAAACCATGTGGCCACTCCAAAAGAGGATACAGCATTTAGCGACTCTTCAGAGCAAGTGAACTTTGATTCTGAGGATTCCTCCTGCCTCCCTGAA

GACTTGAGTCTTTCAAAGCAACTGAAAGTCCAAGTCAAAGAGGAGCCTGTGGAGGAGGCAGAGGAGGAGGCTCCTGAGGCTAGTGCAGCTCCCAGGGAGG

CTGGCCCCAGCAAGGAGACCGGCCTATGGCCCTGTGAGAAATGCGGAAAGATGTTCACGGCACACAAGCAGCTGGAGCGGCACCAGGAGCTGCTGTGTTC

TGTGAAGCCCTTCATCTGCCACGTATGCTACAAAGCCTTCCGTACCAACTTCCGACTCTGGAGTCACTTCCAGACCCACATGTCTCAGGCTACAGAGGAG

CCTGTGCAGAAAGAATCAGAGGTGTGTCCTGTGCCCACAAACTCCCCCTCCCCACCACCTCTGCCACCTCCGCCACCCTTGCCCAAGATTCAGCCCCTGG

AGCCAGACAGCCCCACAGGCCTGCCTGAGAACCCAACCCCAGCTACAGAGAAGCTGTTTGCACCCCAGGAGTCAGATACCCTCTTCTACCACGCCCCACC

CCTTTCAGCAATCACATTTAAAAGACAGTTCATGTGCAAGCTCTGCCATAGGACATTCAAGACGGCCTTCAGTCTTTGGAGTCATGAGCAGACACACAAT

TAAAGGACCTACCCCTTTCACCTATCACAAAGTAGCAGGCCCTTGGCTTGTAAACTGTGTCCTAAGACAGAATATTTGAAAAAATAATAATAATAAAGGT

TGGAAATTATTATGTTTGAATTTTAAGTTTGGGATGAATTAATACTGGCTAGAAATGACCTCACAGCTTTCTGGACCTCAGCAGCAGGGGTTTGATTCTA

TTACTATTGAAGTTGGACTAATGTTGGTGATTGAGGTTTTTGGTTTCTGAGTAGTGGGATGCTTGGGAAGTGGGTTTTTTGTTTGTTTGGTTGGTTGGTT

TTGGTTTTTTTTTGTTGTTGGTTTTGTTTTGTTTTTGATTATTGCAGACACCTAAATTTGAGGTAACCTTTAGCCATGTTTCTAAGGCCAAAAAAACATA

CAAGGAAGAAGGGGAGTCATTTGCAGTATTGAGTCAGATTTTAGACTACTTTAGCAATAAGAAAAGGCAAGCCCCAACTTTAGTAAAGTATCCTAACACT

TGATAAGAAAAAAACTTGGTATTTTGTGGTCCTATAAAACTTCCTTTTTGTATGAAAATTGTGAGACTTTAAATCAGCAATAGTCACACTTAGATTTTTT

TTAATAAAAGAACAATCTGTCAATTACATCATACAATCAGTGATGGTCTGTTCTAAGGGAGGCAGAGCAATAGAAGCGTGTTTGTGGGGTCCTCTACAGT

CAGCTGCAACAGCTTAGTTGTGAAAGCCGCTAAAGTCTGTGGTGTGTTCATAGCATGGCTTTCAACTGGGGCTTTAGAACTGACAATGTCTGCTCTCTGT

CAGCTTGAAACTCGGGTGTCATTGAGATAAGCAGTGCTAGCATGAGGTTAGCAGAGCATAGCCTTACCACATCCTAGACCACCATTCTCTCTCTAGAGGC

TTCAGAGATTGGAGGAAATGCCGTGTTGCAGTTTCCATGTGCTTTCCAAGAACTGTACACACAACATAGACATTTCCTGCCTGTCTTTTGTGAGTACTTC

TGTGGGGTTATTGGAGTGGACAGCAGTGGAAATGTCACTACATGATATGCAAGCGTGGATTAAAGCACTAGCAAGAGGCCAAAATTAGTTTTTGCTACTT

GATTTGGTACCTTAGGGTTTGGGCTCCTCTGGTTTTTTCTTGTTTTTTTGTTTGTTTGTTTGTTTGTTTTTTTGTTTTTTTTTTTTTTTTTTTTTTGCTT

TTTGGTTTGTTCCTTGCAGGTTATAATTAAATCTCTCCATAGGCAGAATCCAAAGTTCAGTGAAATATTTCAAAAGACAAAGGGAAGATCACTCCTGGAA

AGGAAATTAGGGGGATGCAAATTCCCTATTCACTTTTGCTACAAGCTGTTTCTTCACATTTTCAAGGTGTGATCTAACAGAGACACTGGCCCATCTGCTC

ACCAGCATTCTACACCCATGGTAGCAAAGGCAATCTTGATATTGAAACTTTTTTTTTAATAAATTACTAATTGACTTTGTATATTATAGAAGCTATATGT

GGAATTTTGCCTTTTATCTTTTCACTTGAAAAAGCAATCAGAAATCCCTAAATATGTCTGCATTTCCTATTTTGTTTCTTAAATTTTGCAAAGAAGGGAA

ATAAAATTAGGTTGCAGTTATTAATTCTTGCCATCTGCTTTCTTAAACTATGCATTTTAGAGATGAAACTAAAAGTGTCCACCATGTGATGAATGAAGCT

AGTGCCAGGCTAGGTAGCTGTCCACTGAACTTCTTCCCTGTGGTGAGTGAATGGTCTCTCCTCAGAGTGTTACTTCTTTTAAGACCATCTCTCTGCATGG

TCATCTCCTGTGTAGTTACAGAGTGATAACCTCCAGACCTGGCATTGCCAGCTCCTGCCCCAACACTTGAACCTGTGCTACGTTTTTGAAGATTTATAAA

GTAACATTGTTGCAAAAAAAAAAAATGTATTTTTGATCTAAATACAGGTTCTGCATATCTGTTAGGTTTTACAAATTACCAGTGTTTGTCACCTTTTTTT

GTCTAGGAAGAAAACATAAGATTTCAAATAAATTTTTGAACCAAAAACATTTATAATGCAGTTGTGGTTTTTCTATTGCTTTTTATACTGTATCTTGAAA

GACATCGGGCTGCAAGAATTTATTTTGATGTCAAACTCTATCCTTCCATTCATGTAACTATTTCAAATGCTAAGAAACTAATAAAAAACAGTAATCACTT

TTTGCAGTAAACAGTTTTTTAGAGAATGTTTATCTCAGCTAGCAGGCAGATGTTTAGTGAAATAAATAGGTCTTTCACCACTGTAAATCTTTAGATAGTA

GAGATATTCTTGTAAATGTTTTTCTAATTGTACTAATTTTTACAAGTATAGAAAGCTCATTGTTTTTTGTAATTATTTAAGATGCCTGCTTTTTTATGCA

GTTGTGGAAAGAATGTAAACTTTTAATATATTCTTTGTTAACCTGCAAAC
Translation
 - UNI26143 - MMHSVQRAHKHSGEEERRKMCACQ - UNI2902 - - UNI4689 - IKCRMEGLLHYINPAHAISLLSALNEERLKGQLCDVL

LIVGDQKFRAHKNVLAASSEYFQSLFTNKENEAQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKGSLAAVQELGYSLGISFLTNIVAKAPQAPFPACPNRK

RVPVEDDETSSQKRSVIVCQGRSEVPGKASGPAMQDLSHTARASPSASVKTTISKPHVAKPPEQLHSLPLTEKSWTKDSAAVYAKSLEQAGALDDPNRGS

LVKRNTVLPPKPSQDREATDDKPGVSSQLPKGKAIELALKRPRPPVLSLHSSSETPYLLKETSKGGGQGEDRNLLYYSKLGLVVPSGGPASANQSIDRSG

PLVKSLLRRSLSMDSQVPVYSPSIDLKSSQGSSTAANEAPGSVFCSMSQKSSLKDCSEKKALDDRPQVLQPHRLRSFSASQSTDREEASPVTEVRIKTEP

SSPLSDPSDIIRVTVGGDAAAAAVAAAAAAAATRDLPLKTEEDQRDMSRLPAKRRFQTDRRSPLKKAKANEHGPAVSEENCEEGRSPPSLDSNFPDSDLN

REEFGELEGTRPNKKFKCKHCLKIFRSTAGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVRERE

IKKALIIKLRRSKPGFQGQSSSPAQQVIKRNLRSRAKGAYICAYCGKAYRFLSQFKQHIKMHPGERPLGVSRAAKPKERALARAVENKEVYPCRLCNAKL

SSLLEQGNHERLCRNATVCPYCSLRFFSPALKQEHEDRCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQNNMALAENFALATLDHNGEVAAASRPQTEPS

KVNHVATPKEDTAFSDSSEQVNFDSEDSSCLPEDLSLSKQLKVQVKEEPVEEAEEEAPEASAAPREAGPSKETGLWPCEKCGKMFTAHKQLERHQELLCS

VKPFICHVCYKAFRTNFRLWSHFQTHMSQATEEPVQKESEVCPVPTNSPSPPPLPPPPPLPKIQPLEPDSPTGLPENPTPATEKLFAPQESDTLFYHAPP

LSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN

For any suggestions or comments, please send an email to unitrap@crg.es