Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046974 (BC053393)
Chromosomal location
Chr 11: 46385026 - 46402733 (+)
Description
not available
RefSeq_dna
NM_001025435 
RefSeq_peptide
NP_001020606.1 
MGI
MGI:3039605 
Uniprot/SPTREMBL
Q7TQ03 
Human Ortholog
ENSG00000113249 (HAVCR1)
Omim not available
UniTrap UNI31258
Vector Insertion
Chr 11: 46397960 - 46399701
Public Clones IST11357H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050937
Sequence
GAAGAACTGGAGAGACTCAGTTTTCAACAACTCAAGGGAAGGTGTGGACAGGAGATAAGGATGGAATTCTGGGAGAGCTGAGTCTTTATCCATCAGCTGC

TCGGCAAGAGTCCATCAGCAGCAGAGGATTAGAAGGAGAGACTAACAAGAAGTTGTGGCTTTCTCCTAACTG GTCAACGTCATGGTGCTCCCTCAAGTC

CTCCTTTCGACATTCCTACTCCTTCTCCCAG CTGCTTCAGGAGCGTTCCAGGAAGTCCATGGAACAGGAGGTGACCCTGTGACGCTTCCATGCTCTTAT

CCTGAATCTCGTATACTCTCATTTGTGTGCTGGGGCCGAGGCGAATGCGCTTCTGATACATGTGGACAAACATTGGTCTGGACTGATGGACACCGAGTCA

ACTATCGGACAAGCAACCGCTACCAGATAAACTCGCAGCTTCTTCAAGGAAATGCATCCTTGACAATCGAGTACGCCTATGAGAGCGACAGCGGTCTCTA

CTGCTGTCGAGTGGAAATGAAGGGATGGGATGGCGTGCAGACACTGACCACCTCACTGCAGATTCAACCAG GAAGCAGTTCAGCCAGGACTAAAGGCCT

TGCTATTGGACTCTCCATTTTCTTTCTGCTTCTGGTTCTTGTGGGCACATTAGTTATCACAA - UNI31258 - ATTACATCCTTATGAAAAAGAGGC

CAGAATCTCCAAG CTTGGTAGCATTATGTGTTTCTAAGATCAGAACTTTACTAAATAAAGAGGTTGCTTCACCATGAGCACAAGATGACGTCTACAATA

TTGAAGACAGTCCTCATATCAAAGCTTAAGTTTCAGGAGAAGACCTCTACGGCATATCACCAGTCTGGACGCCCCTGAAGTGTCAAGACTATTTCCCGTC

AGTTCATCTTGAATTCCCACTTTGCAGCTGCAGTGGAGAGGATGGACCTCTAGCTGTCTCTTCTCACACTCACTGTTGACATGATGCTGTCTCTCCACAC

TATAGATCCTTCTTTCAAACACGAACACTTTAACATTTTGGGTGTCCTTTAGGCCCCAAAACTCTTTTATCTGTGAAAGACAATTATTGGTAACTTCTAT

CCTGGTTACTAAAACCATCCAGCAAAGAGGAATAGGACTTTAAAGTAAAACTAAAATAAAACAAATGTGGGGAGGGTGGGGATTAATTTGGAAGTACTTC

GTGGTTGTGTCTTGTTTATTTAATTGGTGGATGCCATGCAGAAAGAGCTGCAGTGGGCAAGTGAGCTCCCTAGAGATGGCCCCCTGTCCTGCTCAGCTCT

GATAGGAGCACTGTGGTGAGGCCACAAAGACTTCGTCCCAGGATGGCTTCCTGCTACTGATGTACTTTCCCAGATTTGTCATTGCCATACTCCTCACTTA

TGTGGCTTGGTGTGAATGGAGACCAAAGATCTCCACTGTCTATAGCCTGGTGTAGTTACTTCCTGAGTGATAGCTCACCCTATTGGGCATATTTCCTGCA

GATCATCATGAAAATGAACTTTCATGAATTAATGCTGTTTAGATGAATTAATGACTGTACAGAATTCCTTGATTCAAATCATTTTAGGAAGAAAATTTAA

GGAGATAATTTTAGCTGCTTTGCCAGGAAGATGTGATAAAGTTAGAATCAAGAATAGCATGTGCCCCCTTCTCATAGAATAGTAAGTAAATATATATATA

AGGAATACAATAAGCTTTTATAAATTGCAATAAGAAGAGAAATAGGCTTGGAACAAATTTGTGATCAAGGAAAAACACTCATTCTAGGTCAGATCCAAGG

ATGAAGCCACAGGTGAGCACCATGATAAAGTGAGGCCATGGGAAACTGTTGCTTTGAACTTAAACTGAGCTTATAGAATGAAATACTGCTTTGAATTTAC

TATGAGCATCCTTCTGTAATTCCCTTTTTATGTAACATTTTATCTGTGAGGTAATTTTATAAAGAACTTTTGTCTAAGAAGGTATAAAGAGGCTGAAAGA

AAAAAATAAAGTGTGGTTATTGGGGCTCTGCTCCATCCATCAAATGTGT
Translation
 MVLPQVLLSTFLLLLPA AASGAFQEVHGTGGDPVTLPCSYPESRILSFVCWGRGECASDTCGQTLVWTDGHRVNYRTSNRYQINSQLLQGNASLTIEY

AYESDSGLYCCRVEMKGWDGVQTLTTSLQIQPG GSSSARTKGLAIGLSIFFLLLVLVGTLVITN - UNI31258 - NYILMKKRPESPS SLVALCV

SKIRTLLNKEVASP

For any suggestions or comments, please send an email to unitrap@crg.es