Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047030 (Spata2)
Chromosomal location
Chr 2: 167306933 - 167318345 (-)
Description
spermatogenesis associated 2 Gene [Source:MGI (curated);Acc:Spata2-002]
Human Ortholog
not available
Omim not available
UniTrap UNI38592
Vector Insertion
Chr 2: 167310657 - 167318346
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109211
Sequence
GTTCTCGGTTCCCGGAGCCGGCGGGAGCGGCCGGGCCGTGTGGGCCTGTGCTTTGGAGGCGCTCGCTTTCCTGGCAGGCAGCGGTGG - UNI38592 -

 AGCATGCGCTGGTCCATGGGCACCAGGCCAGTTCTTCATGTGATGTGCCAGCCTCCAGTTCCAGAGCCATGGGGGAGATGAGGTAGCCCTTGGGTTTGA

TTTGGGGAAGCCCAGTTCAATGGATACGAAGTACAAGGATGACTTATTCCGGAAGTACGTGCAGTTCCATGAGGGCAAAGTGGACACCACCCCCGGCAAC

CAGCAGCCTGGCAGCGATGAGTACCTGCGCGTGGCAGCTGCCACCCTGCTCAGCCTGCACAAGGTGGACCCTTTATATCGATTTCGGCTGATCCAGTTTT

ATGAGGTGGTGGAGAGCTCCCTCCGCTCGCTGAGCAGCTCCAGCCTGAGTGCTCTGCACTGCGCCTTCAGCATGCTGGAGACAATGGCCATCAACCTCTT

CCTGTTCCCCTGGAAGAAGGAGTTCCGCAGCATCAAG - UNI38592 - ACCTACACTGGCCCTTTTGTTTACTATGTCAAGTCCACGTTGCTGGAGA

AGGACATCCGAGCCATTCTAAGGTTCATGGGCTACGAGCCTGAGTTGGGGACTGTGTACAAACTCAAAGAGCTTGTGGAGTCCCTCCAGGTGAAGATGGT

CTCCTTTGAGCTCTTCCTGGCCAAGGTCGAGTGTGAGCAGATGCTGGGCATCCACTCGCAGGTGAAGGACAAGGGCTACTCAGAGCTGGACGTGGTGGCT

GAGCGCAAGGGCAGCACGGAGGATGCGCGCGGGTGCTCAGATGCTCTGCGGAGGCGGGCTGAGAGTCGGGAGCACCTGACCACTTCCATGGCTCGTGTGG

CACTCCAGAAATCAGCCAGTGAGCGAGCAGCCAAGGACTACTACAAGCCCCGGGTGACCAAACCCTCCAGGTCTGTGGATGCCTACGACAGCTACTGGGA

GAGCAGGAAGCCCCCTTCAAAGGCCTCACTGAGTCTGCGCAAGGAGCCCCTGGCCATGGATGTAGGGGAAGACTTGAAGGACGAGATCATCCGCCCATCC

CCCTCATTGCTGGCCATGTCCAGCTCCCCCCATGGTAGCCCTGATGACCTTTCCTCCATCTCCTCCATCAATGGCCTTGGCCTTCTTCGTAGTACATACT

TTTCCACTCAGGATGACGTGGACCTGTATACGGATTCAGAACCCAGGGCCACCTACCGGAGGCAGGATGCTCTGCGGCCCGATGTGTGGCTGGTCAAAAA

TGATACCCACCCCATCTACCACAAGCGTTCACCCCCCACCAAAGAGTCTGCCCTCTCCAAGTGCCAAAACTGCGGCCTGTCCTGCAGCTCCTCCCTCTGC

CAGCGCTGTGACAGTGTGCTGGTCTGTCCTTCG GCCTCTCCCCTCCTAGGTGTGTCTCACTATAGGAGATCGCTGTGATCCGGGTAGTTGAGTATATGT

TAATTTAAAATGCACATATTTTGCATTTGATTTCTACGGAGTTGAAATGTTGAGAGATTT
Translation
 - UNI38592 - MDTKYKDDLFRKYVQFHEGKVDTTPGNQQPGSDEYLRVAAATLLSLHKVDPLYRFRLIQFYEVVESSLRSLSSSSLSALHCAFSML

ETMAINLFLFPWKKEFRSIK - UNI38592 - TYTGPFVYYVKSTLLEKDIRAILRFMGYEPELGTVYKLKELVESLQVKMVSFELFLAKVECEQMLG

IHSQVKDKGYSELDVVAERKGSTEDARGCSDALRRRAESREHLTTSMARVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPSKASLSLRKEP

LAMDVGEDLKDEIIRPSPSLLAMSSSPHGSPDDLSSISSINGLGLLRSTYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLVKNDTHPIYHKRSPPTKES

ALSKCQNCGLSCSSSLCQRCDSVLVCPS ASPLLGVSHYRRSL
Transcript ENSMUST00000057627
Sequence
GTTCTCGGTTCCCGGAGCCGGCGGGAGCGGCCGGGCCGTGTGGGCCTGTGCTTTGGAGGCGCTCGCTTTCCTGGCAGGCAGCGGTGG - UNI38592 -

 AGCATGCGCTGGTCCATGGGCACCAGGCCAGTTCTTCATGTGATGTGCCAGCCTCCAGTTCCAGAGCCATGGGGGAGATGAGGTAGCCCTTGGGTTTGA

TTTGGGGAAGCCCAGTTCAATGGATACGAAGTACAAGGATGACTTATTCCGGAAGTACGTGCAGTTCCATGAGGGCAAAGTGGACACCACCCCCGGCAAC

CAGCAGCCTGGCAGCGATGAGTACCTGCGCGTGGCAGCTGCCACCCTGCTCAGCCTGCACAAGGTGGACCCTTTATATCGATTTCGGCTGATCCAGTTTT

ATGAGGTGGTGGAGAGCTCCCTCCGCTCGCTGAGCAGCTCCAGCCTGAGTGCTCTGCACTGCGCCTTCAGCATGCTGGAGACAATGGCCATCAACCTCTT

CCTGTTCCCCTGGAAGAAGGAGTTCCGCAGCATCAAG - UNI38592 - ACCTACACTGGCCCTTTTGTTTACTATGTCAAGTCCACGTTGCTGGAGA

AGGACATCCGAGCCATTCTAAGGTTCATGGGCTACGAGCCTGAGTTGGGGACTGTGTACAAACTCAAAGAGCTTGTGGAGTCCCTCCAGGTGAAGATGGT

CTCCTTTGAGCTCTTCCTGGCCAAGGTCGAGTGTGAGCAGATGCTGGGCATCCACTCGCAGGTGAAGGACAAGGGCTACTCAGAGCTGGACGTGGTGGCT

GAGCGCAAGGGCAGCACGGAGGATGCGCGCGGGTGCTCAGATGCTCTGCGGAGGCGGGCTGAGAGTCGGGAGCACCTGACCACTTCCATGGCTCGTGTGG

CACTCCAGAAATCAGCCAGTGAGCGAGCAGCCAAGGACTACTACAAGCCCCGGGTGACCAAACCCTCCAGGTCTGTGGATGCCTACGACAGCTACTGGGA

GAGCAGGAAGCCCCCTTCAAAGGCCTCACTGAGTCTGCGCAAGGAGCCCCTGGCCATGGATGTAGGGGAAGACTTGAAGGACGAGATCATCCGCCCATCC

CCCTCATTGCTGGCCATGTCCAGCTCCCCCCATGGTAGCCCTGATGACCTTTCCTCCATCTCCTCCATCAATGGCCTTGGCCTTCTTCGTAGTACATACT

TTTCCACTCAGGATGACGTGGACCTGTATACGGATTCAGAACCCAGGGCCACCTACCGGAGGCAGGATGCTCTGCGGCCCGATGTGTGGCTGGTCAAAAA

TGATACCCACCCCATCTACCACAAGCGTTCACCCCCCACCAAAGAGTCTGCCCTCTCCAAGTGCCAAAACTGCGGCCTGTCCTGCAGCTCCTCCCTCTGC

CAGCGCTGTGACAGTGTGCTGGTCTGTCCTTCGGCCTCCAAGCCCAGCGCTTTCCCCAGCAAGGCTTCTGTACACGACAGCTTGGCCCACGGGGCACCTA

TGCGGGAGAAGTATGTGGGCCACCAGACTCAGGGCCTTGACCGGCTGGCACCTGTCCACTCAAAGCCCAAGCCCTCTACCACAGCCACCTCCCGCTGTGG

CTTCTGTAACCGTGCAGGTGCCACCAACACGTGCACCCAGTGTTCAAAAGTTTCCTGTGACGCCTGCCTCGGCGCCTACCACTACGACCCGTGCTGCAGA

AAGAGTGAGCTGCACAAGTTCCTGCCCAACAGTCAGCTGAACTACAAGTCCGCCCCGTTCTCCCAGCTCGTGTACAGATAG
Translation
 - UNI38592 - MDTKYKDDLFRKYVQFHEGKVDTTPGNQQPGSDEYLRVAAATLLSLHKVDPLYRFRLIQFYEVVESSLRSLSSSSLSALHCAFSML

ETMAINLFLFPWKKEFRSIK - UNI38592 - TYTGPFVYYVKSTLLEKDIRAILRFMGYEPELGTVYKLKELVESLQVKMVSFELFLAKVECEQMLG

IHSQVKDKGYSELDVVAERKGSTEDARGCSDALRRRAESREHLTTSMARVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPSKASLSLRKEP

LAMDVGEDLKDEIIRPSPSLLAMSSSPHGSPDDLSSISSINGLGLLRSTYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLVKNDTHPIYHKRSPPTKES

ALSKCQNCGLSCSSSLCQRCDSVLVCPSASKPSAFPSKASVHDSLAHGAPMREKYVGHQTQGLDRLAPVHSKPKPSTTATSRCGFCNRAGATNTCTQCSK

VSCDACLGAYHYDPCCRKSELHKFLPNSQLNYKSAPFSQLVYR

For any suggestions or comments, please send an email to unitrap@crg.es