Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047109 (Cldn14)
Chromosomal location
Chr 16: 93919278 - 94009082 (-)
Description
claudin 14 Gene [Source:MGI (curated);Acc:Cldn14-001]
RefSeq_dna
NM_019500 
RefSeq_peptide
NP_062373.3 
UniGene
Mm.328716 
MGI
MGI:1860425 
Uniprot/SWISSPROT
Q9Z0S3 
Uniprot/SPTREMBL
A2RSP0 
Human Ortholog
ENSG00000159261 (CLDN14)
Omim 605608 - CLAUDIN 14  
UniTrap UNI17054
Vector Insertion
Chr 16: 93942651 - 94008769
Public Clones IST13251G4 (tigm) IST11019E6 (tigm) IST10478G5 (tigm) IST10496E10 (tigm)
IST10826C1 (tigm) IST10889E3 (tigm) IST14800F3 (tigm) IST13264E2 (tigm)
IST12484B7 (tigm) IST13950B6 (tigm) IST11965B10 (tigm) IST14917D9 (tigm)
IST11992B5 (tigm) IST11477D6 (tigm) IST10361A2 (tigm) IST10084H9 (tigm)
IST14915G11 (tigm) IST11358G11 (tigm) IST12577D1HMF1 (tigm) IST14396A11 (tigm)
IST12606H11 (tigm) IST10371F1 (tigm) IST10024D7 (tigm) IST13698D7 (tigm)
IST10721B1 (tigm) IST10361B1 (tigm) IST14726C8 (tigm) IST14745D9 (tigm)
IST13792H7 (tigm) IST12316A3 (tigm) IST14699C3 (tigm) IST13040E3 (tigm)
IST12511H1 (tigm) IST14637C7 (tigm) IST12243C6 (tigm) IST10003B1 (tigm)
IST10414B7 (tigm) IST14820C7 (tigm) IST12459D1 (tigm) IST10242C5 (tigm)
Private Clones OST450232 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30483
Vector Insertion
Chr 16: 93920283 - 93942512
Public Clones CMHD-GT_297H2-3 (cmhd) IST10751B6 (tigm) IST13661B10 (tigm) IST14943E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050962
Sequence
GTCGGAATGGCATGTTCTGAAAGGGCAGCGTTGATAGCTGAAACTAGGTGCGCCTCAGGCCGGGGCTGTGGGAAGCCCGAGCATCTTGGGCACCAGCAAA

GTTTCTAGCAGCCTTGGGAAGGAGAGGAAAGTCAGGTGGATCTGATTGGTGGGAAAGGTGACCTGGGGAAACTTGCCCTGTGGTTCATACAACCTGCCAG

GCAGAAGCAGGAGCCAGGGGCACCTGAGCAAGAAACCCCATAAGATGTTCAAGTGGAGTTCCAGACAGGCACCTGGATATAGTTCTGGACCCGGAGGGGG

ACGCGTCAACACT - UNI17054 - GGGCTGCATGGCCCAGCGATCTGGACAAAGGCCAAGAAGCCAAAGACTGTTGAAGCCGCAGTCTCCACTCTTC

TACTGACGCCAGCGACCACCCAGCCCAGCCAGGCCATATGGCCTCCTGCTTGCCTGATGTATGAG - UNI30483 - GCTTCCTGCGGGCACCTAAGG

ACCAGATCCATCCCTGGGGACCTGGGCACTGCTCAGCGCGGCTAGCAGGGGCCCTTAGCCATGGCCAGCACAGCGGTCCAGCTCCTAGGCTTCCTGCTTA

GCTTCCTGGGCATGGTAGGAACGCTCATCACCACCATCCTGCCACACTGGCGGAGGACGGCCCATGTGGGCACCAACATCCTGACTGCCGTATCCTACCT

GAAGGGACTGTGGATGGAATGTGTGTGGCACAGCACAGGCATCTACCAGTGTCAGATCTACCGCTCACTGCTGGCGCTGCCCCGGGACTTGCAGGCCGCC

CGGGCGCTCATGGTCATCTCCTGCCTGTTGTCGGGCATGGCCTGCGCCTGCGCAGTAGTGGGCATGAAGTGCACACGCTGCGCCAAAGGCACACCCGCCA

AGACCACCTTTGCAGTGCTGGGGGGCGCGCTCTTCCTGCTGGCCGGCCTGCTGTGCATGGTGGCCGTGTCCTGGACCACGAATGACGTGGTGCAGAATTT

TTATAACCCGCTGCTGCCCAGTGGCATGAAGTTTGAAATCGGCCAGGCCCTGTACCTGGGCTTCATCTCCTCATCCCTGTCTCTCATCGGGGGCACCCTG

CTCTGCTTATCCTGCCAGGACGAGGCCCCCTACAGACCCTACCCGCCCCAGTCCAGGGCCGGAGCTACCACCACGGCTACCGCCCCTGCCTACCGCCCAC

CAGCGGCCTACAAGGACAACCGTGCCCCCTCGGTGACCTCAGCCGCGCACAGTGGGTACAGGCTGAATGACTACGTGTGAGTTCCTTCCCCGGGCTTCTG

CCAGGGATGCTGGGCCCCAAAGGACCAATGATGGATGTGGGAAGGATGCAGAGAGCAAGCCCGGAACACAGGGAAGGAGGTGCTCTTCAAAGCAAAGACT

TCTAAAAAGTGCTGGTTTTTTATTTATTATATGTATTTATGCGGGTGGCTTAATAAGAGCTCAATAAAGAGTGTCTTGGAAGCG
Translation
 - UNI17054 -  - UNI30483 - MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLA

LPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSS

LSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV

For any suggestions or comments, please send an email to unitrap@crg.es