Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047126 (Cltc)
Chromosomal location
Chr 11: 86508161 - 86570995 (-)
Description
clathrin, heavy polypeptide (Hc) Gene [Source:MGI (curated);Acc:Cltc-001]
RefSeq_dna
NM_001003908 
RefSeq_peptide
NP_001003908.1 
UniGene
Mm.254588 
MGI
MGI:2388633 
Uniprot/SWISSPROT
Q68FD5 
Uniprot/SPTREMBL
Q3TJ98 Q3UPJ3 Q5SXR6 Q8K2I5 Q3TAN1 Q3TYQ2 Q3U0H2 Q80U89 Q5SXR7 
Human Ortholog
ENSG00000141367 (CLTC)
Omim not available
UniTrap UNI4112
Vector Insertion
Chr 11: 86570749 - 86570995
Public Clones AN0633 (sanger) BGB135 (baygenomics) XL080 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29524
Vector Insertion
Chr 11: 86550572 - 86570995
Public Clones (sanger) P107F12 (ggtc) IST10874G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18758
Vector Insertion
Chr 11: 86550572 - 86550781
Public Clones not available
Private Clones OST415005 (lexicon) OST235954 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21410
Vector Insertion
Chr 11: 86550572 - 86550781
Public Clones not available
Private Clones OST331950 (lexicon) OST237677 (lexicon) OST88744 (lexicon) OST81613 (lexicon)
OST51294 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5782
Vector Insertion
Chr 11: 86547347 - 86550572
Public Clones CSI228 (baygenomics) XC296 (baygenomics) XE370 (baygenomics) XC706 (baygenomics)
A015D05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28000
Vector Insertion
Chr 11: 86544219 - 86544334
Public Clones not available
Private Clones OST42702 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34911
Vector Insertion
Chr 11: 86535676 - 86538774
Public Clones IST14048A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4754
Vector Insertion
Chr 11: 86533126 - 86533751
Public Clones AX0189 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2052
Vector Insertion
Chr 11: 86531399 - 86531564
Public Clones AW0865 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15503
Vector Insertion
Chr 11: 86519474 - 86520362
Public Clones PST6724-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7641
Vector Insertion
Chr 11: 86517732 - 86518141
Public Clones RRR676 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060766
Sequence
ATTGCGGCTCTCCCGGCCCCTGGAGCCTCCGCCCCCGACCCAAGCTCTCTCGTCTGCCTGCCAGTTCCCTGCGTCCCCGGAGAGTATCCCTCTGAGCCCA

GCCTCCCCTCCCCTTCCCCGTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGGCACTGCCCTGCAGCCCCAGTGACAGGAGGAGACCATACTCCCCGACAG

CGCCATGGCCCAGATTCTGCCCATTCGCTTTCAGGAGCATCTCCAG - UNI4112 - - UNI18758 - - UNI21410 - - UNI29524 - CT

CCAGAACCTGGGTATCAACCCAGCAAACATTGGCTTCAGTACCTTGACTATGGAGTCAGACAAATTCATCTGCATTAGAGAAAAAGTGGGAGAGCAGGCC

CAGGTGGTAATCATTGATATGAATGATCCAAGTAATCCAATTCGAAGACCAATCTCAGCAGACAGTGCCATCATGAATCCTGCCAGCAAAGTGATTGCAC

TGAAAGGTATAAAGGATT - UNI5782 - CTGGCAAAACTCTTCAGATATTTAACATTGAAATGAAAAGTAAAATGAAGGCCCATACCATGACTGATG

ATGTCACCTTCTGGAAATGGATCTCTTTGAATACGGTTGCTCTTGTTACGGATAATGCAGTTTATCACTGGAGTATGGAAGGAGAGTCTCAGCCAGTGAA

AATGTTTGATCGTCATTCTAGCCTCGCAGGATGCCAGATCATCAATTACCGTACAGATGCAAAGCAGAAATGGTTGCTTCTCACTGGCATATCTGCACAG

 CAAAATCGTGTGGTTGGAGCTATGCAGCTGTATTCTGTAGATAGGAAAGTTTCTCAGCCTATTGAAGGGCATGCAGCTAGTTTTGCACAATTTAAGATG

GAAGGAAATGCAGAAGAATCAACATTATTTTGTTTTGCTGTGCGGGGTCAGGCAGGAGGAAAG - UNI28000 - TTACATATCATTGAAGTTGGTAC

CCCACCCACAGGGAATCAACCCTTCCCAAAGAAGGCAGTGGATGTTTTCTTTCCTCCAGAAGCACAAAATGACTTTCCTGTTGCAATGCAG - UNI280

00 - ATCAGTGAAAAGCATGATGTGGTGTTCTTGATTACCAAGTATGGTTATATTCACCTCTATGATCTTGAGACTGGCACGTGCATCTACATGAACAG

AATCAGCGGAGAAACCATCTTCGTCACTGCACCTCATGAAGCCACAGCTGGAATAATAGGAGTCAACAGAAAGGGACAG GTCCTGTCAGTTTGTGTGGA

AGAGGAGAACATAATTCCTTATATCACCAATGTCCTACAAAATCCTGACTTGGCTCTGAGAATGGCTGTGCGGAACAACTTAGCTGGTGCTGAAGAACTC

TTTGCCCGGAAATTTAATGCTCTCTTCGCCCAGGGAAACTACTCAGAGGCTGCAAAGGTGGCTGCTAATGCTCCAAAG - UNI34911 - GGAATCCT

TCGTACTCCAGATACCATCCGTCGATTCCAGAGTGTCCCAGCTCAGCCAGGTCAAACGTCACCTCTACTTCAGTATTTCGGAATCCTTTTGGACCAGGGC

CAGCTGAACAAATACGAGTCCTTAGAGTTATGTAGACCTGTACTTCAGCAAGGGCGGAAACAGCTTTTGGAGAAATGGCTGAAAGAAGATAAG - UNI3

4911 - CTGGAATGTTCTGAAGAACTGGGTGATCTCGTTAAATCTGTGGACCCAACATTAGCACTGAGTGTTTACCTCAGGGCCAATGTACCTAATAAA

GTCATCCAGTGCTTTGCAGAGACAGGCCAAGTCCAGAAGATTGTTTTATATGCTAAAAAA - UNI34911 - GTTGGCTATACTCCAGACTGGATCTT

TCTCCTGAGAAATGTCATGCGGATCAGTCCAGATCAAGGACAGCAGTTTGCTCAAATGTTAGTTCAGGATGAAGAGCCTCTTGCTGATATCACCCAG AT

TGTGGATGTCTTTATGGAATACAATCTAATCCAACAATGTACTGCCTTCTTACTTGATGCTTTGAAGAATAATCGTCCCTCTGAAGGTCCTTTGCAGACG

CGATTGCTTGAGATGAACCTTATGCACGCACCTCAA - UNI4754 - GTTGCAGATGCCATTCTCGGGAATCAGATGTTCACCCACTATGACCGGGCT

CATATCGCCCAGCTGTGTGAGAAGGCGGGCCTGCTGCAGCGTGCATTAGAACACTTCACCGATTTATATGACATAAAACGTGCAGTTGTTCATACCCATC

TTCTTAACCCTGAG TGGTTAGTGAATTACTTTGGGTCCTTATCAGTTGAAGATTCCCTAGAATGCCTCAGAGCCATGCTGTCAGCTAATATTCGTCAAA

ATCTACAGATCTGTGTTCAGGTGGCTTCTAAATATCACGAACAGCTGTCAACTCAGTCTCTGATTGAGCTCTTTGAATCATTCAAGAGTTTTGAAG - U

NI2052 - GTCTCTTTTATTTTCTGGGGTCCATTGTTAACTTTAGTCAGGACCCAGATGTGCACTTTAAATATATTCAGGCGGCTTGCAAGACTGGGCA

AATCAAAGAAGTGGAAAGAATCTGCAGAGAAAGCAACTGCTATGATCCCGAGCGAGTCAAGAATTTTCTCAAG - UNI2052 - GAGGCAAAACTAAC

AGATCAGTTGCCACTTATCATTGTCTGTGATCGGTTTGACTTTGTCCATGACCTGGTGCTGTATTTATATAGAAACAATCTTCAGAAGTATATAGAGATA

TATGTCCAGAAG GTAAATCCAAGTCGACTTCCTGTGGTTATTGGAGGATTGCTGGATGTTGACTGCTCTGAAGATGTCATTAAAAATTTGATTCTTGTT

GTGAGAGGTCAATTCTCTACTGATGAGCTTGTTGCTGAAGTCGAGAAAAGAAACAG ATTGAAGCTGCTTCTTCCTTGGCTTGAGGCCAGAATTCATGAG

GGCTGTGAGGAGCCTGCTACTCACAATGCACTTGCCAAAATATACATTGACAGTAACAACAACCCAGAGAGATTTCTTCGTGAAAACCCTTATTATGACA

GTCGTGTTGTTGGGAAGTACTGTGAGAAGAGAGACCCCCATCTGGCTTGTGTTGCTTATGAACGTGGCCAGTGTGACCTGGAGCTCATCAAT GTTTGCA

ATGAGAATTCCCTCTTCAAAAGCCTTTCTCGCTACTTAGTCCGTCGAAAGGATCCAGAATTGTGGGGTAGTGTGCTACTGGAAAGCAATCCATACAGAAG

ACCGTTAATTGACCAG GTTGTACAGACAGCCTTGTCTGAAACTCAGGACCCAGAAGAAGTGTCAGTAACTGTGAAGGCTTTTATGACAGCAGATCTTCC

TAATGAGCTCATTGAACTGCTGGAGAAAATCGTTCTTGATAACTCCGTATTCAGTGAGCACAG GAATCTGCAAAATCTCCTCATCCTCACTGCAATTAA

GGCTGACCGAACACGTGTTATGGAGTATATTAACCGCCTGGATAATTATGATGCTCCAGATATTGCCAACATTGCCATCAGCAATGAGCTGTTTGAAGAG

GCATTTGCTATTTTCCGGAAGTTTGATGTCAATACTTCAGCAGTGCAG - UNI15503 - GTGTTGATTGAACATATTGGAAACCTGGATCGTGCATA

TGAGTTTGCTGAACGCTGCAATGAGCCTGCTGTTTGGAGTCAACTTGCAAAAGCTCAGTTGCAGAAAGGAATGGTGAAGGAAGCCATTGATTCTTACATC

AAAGCAGATGATCCTTCATCTTACATGGAAGTTGTCCAGGCTGCCAATGCCAGCG - UNI15503 - GAAACTGGGAAGAATTGGTGAAGTATTTGCA

GATGGCACGCAAGAAGGCTCGAGAGTCCTATGTGGAGACAGAATTGATATTTGCACTGGCTAAAACAAACCGCCTTGCAGAATTAGAAGAGTTCATCAAT

GGGCCAAATAATGCTCATATTCAGCAA - UNI15503 - GTTGGTGACCGTTGTTATGATGAAAAAATGTATGATGCTGCTAAGTTGTTGTACAATAA

TGTTTCTAACTTTGGACGCTTGGCATCTACCCTTGTTCACCTTGGCGAGTATCAGGCAGCAGTTGATGGTGCCAGAAAAGCTAATAGTACTCGAACATGG

AAAGAG GTCTGCTTTGCCTGTGTAGATGGGAAAGAGTTCCGCCTTGCTCAGATGTGTGGACTCCATATTGTGGTGCATGCAGATGAATTAGAGGAGCTT

ATCAACTACTATCAG GATCGTGGATATTTTGAAGAACTCATCACCATGTTGGAGGCAGCCTTGGGACTGGAGCGAGCTCACATGGGAATGTTCACAGAG

CTAGCTATTTTGTATTCTAAATTCAAGCCACAGAAAATGAGAGAACACCTGGAGTTGTTCTGGTCGAGAGTGAATATTCCTAAG - UNI7641 - GTG

CTGAGAGCTGCAGAACAGGCTCATCTCTGGGCAGAGCTGGTGTTTCTGTATGACAAGTACGAAGAGTATGACAATGCCATCATTACCATGATGAATCACC

CCACCGATGCATGGAAGGAAGGGCAGTTCAAAGACATCATCACCAAG GTGGCTAATGTGGAACTGTACTACAAAGCAATCCAGTTCTACTTAGAATTCA

AGCCTTTGTTGTTAAATGACTTGCTCATGGTGCTGTCTCCACGGTTGGATCACACTCGTGCAGTCAATTATTTCAGCAAG GTAAAACAGCTACCACTGG

TGAAACCATATTTACGCTCAGTGCAGAACCACAACAACAAATCTGTGAATGAATCACTGAACAACCTCTTTATTACTGAAGAAGATTACCAG GCTCTGC

GAACATCAATAGATGCTTATGACAACTTTGACAACATCTCACTTGCTCAGCGTTTGGAAAAACACGAACTCATTGAATTCAGAAGAATTGCTGCTTATCT

CTTCAAAGGCAACAATCGCTGGAAACAGAGTGTAGAGTTGTGCAAGAAAGACAGCCTTTACAAG GATGCAATGCAGTATGCCTCTGAATCTAAAGACAC

AGAATTGGCTGAAGAGCTCCTACAGTGGTTTTTGCAGGAAGAAAAAAGAGAATGCTTTGGAGCTTGTCTCTTTACCTGTTATGATCTCTTAAGGCCAGAT

GTCGTCCTGGAAACCGCATGGAGACATAATATCATGGATTTCGCCATGCCCTATTTCATCCAGGTCATGAAGGAATATTTGACCAAG GTGGATAAATTA

GATGCTTCGGAGTCGCTGAGAAAAGAAGAAGAACAAGCTACAGAGACACAGCCCATTGTTTATG GTCAGCCCCAGCTGATGCTAACAGCAGGACCCAGT

GTGGCAGTCCCTCCCCAGGCACCTTTTGGTTATGGTTATACTGCACCACCGTATGGGCAGCCACAGCCTGGCTTTGGGTACAGCATGTGA
Translation
MAQILPIRFQEHLQ - UNI4112 - - UNI18758 - - UNI21410 - - UNI29524 - LQNLGINPANIGFSTLTMESDKFICIREKVGEQA

QVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKGIKDS - UNI5782 - SGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHW

SMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQ QNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGK -

 UNI28000 - LHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQ - UNI28000 - ISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGE

TIFVTAPHEATAGIIGVNRKGQ VLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPK - UNI34911

 - GILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDK - UNI34911 - LECSEELGDLVKSVDP

TLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKK - UNI34911 - VGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQ IVDVFMEYN

LIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQ - UNI4754 - VADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTH

LLNPE WLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEG - UNI2052 - GLFYFLGSIVNFSQDPDVHF

KYIQAACKTGQIKEVERICRESNCYDPERVKNFLK - UNI2052 - EAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQK VNPSRLPVV

IGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNR RLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRD

PHLACVAYERGQCDLELIN VCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQ VVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKI

VLDNSVFSEHR RNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQ - UNI15503 - VLIEHIGNLDRA

YEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASG - UNI15503 - GNWEELVKYLQMARKKARESYVETELIFALAKT

NRLAELEEFINGPNNAHIQQ - UNI15503 - VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKE VCFACVDGKE

FRLAQMCGLHIVVHADELEELINYYQ DRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPK - UNI7641 - VLRA

AEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITK VANVELYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSK VKQLPLVK

PYLRSVQNHNNKSVNESLNNLFITEEDYQ ALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYK DAMQYASESKDT

ELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTK VDKLDASESLRKEEEQATETQPIVYG GQPQLMLTAG

PSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
Transcript ENSMUST00000103186
Sequence
ATTGCGGCTCTCCCGGCCCCTGGAGCCTCCGCCCCCGACCCAAGCTCTCTCGTCTGCCTGCCAGTTCCCTGCGTCCCCGGAGAGTATCCCTCTGAGCCCA

GCCTCCCCTCCCCTTCCCCGTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGGCACTGCCCTGCAGCCCCAGTGACAGGAGGAGACCATACTCCCCGACAG

CGCCATGGCCCAGATTCTGCCCATTCGCTTTCAGGAGCATCTCCAG - UNI4112 - - UNI18758 - - UNI21410 - - UNI29524 - CT

CCAGAACCTGGGTATCAACCCAGCAAACATTGGCTTCAGTACCTTGACTATGGAGTCAGACAAATTCATCTGCATTAGAGAAAAAGTGGGAGAGCAGGCC

CAGGTGGTAATCATTGATATGAATGATCCAAGTAATCCAATTCGAAGACCAATCTCAGCAGACAGTGCCATCATGAATCCTGCCAGCAAAGTGATTGCAC

TGAAAG - UNI5782 - - UNI18758 - - UNI21410 - - UNI29524 - CTGGCAAAACTCTTCAGATATTTAACATTGAAATGAAAAGTA

AAATGAAGGCCCATACCATGACTGATGATGTCACCTTCTGGAAATGGATCTCTTTGAATACGGTTGCTCTTGTTACGGATAATGCAGTTTATCACTGGAG

TATGGAAGGAGAGTCTCAGCCAGTGAAAATGTTTGATCGTCATTCTAGCCTCGCAGGATGCCAGATCATCAATTACCGTACAGATGCAAAGCAGAAATGG

TTGCTTCTCACTGGCATATCTGCACAG CAAAATCGTGTGGTTGGAGCTATGCAGCTGTATTCTGTAGATAGGAAAGTTTCTCAGCCTATTGAAGGGCAT

GCAGCTAGTTTTGCACAATTTAAGATGGAAGGAAATGCAGAAGAATCAACATTATTTTGTTTTGCTGTGCGGGGTCAGGCAGGAGGAAAG - UNI2800

0 - TTACATATCATTGAAGTTGGTACCCCACCCACAGGGAATCAACCCTTCCCAAAGAAGGCAGTGGATGTTTTCTTTCCTCCAGAAGCACAAAATGAC

TTTCCTGTTGCAATGCAG - UNI28000 - ATCAGTGAAAAGCATGATGTGGTGTTCTTGATTACCAAGTATGGTTATATTCACCTCTATGATCTTGA

GACTGGCACGTGCATCTACATGAACAGAATCAGCGGAGAAACCATCTTCGTCACTGCACCTCATGAAGCCACAGCTGGAATAATAGGAGTCAACAGAAAG

GGACAG GTCCTGTCAGTTTGTGTGGAAGAGGAGAACATAATTCCTTATATCACCAATGTCCTACAAAATCCTGACTTGGCTCTGAGAATGGCTGTGCGG

AACAACTTAGCTGGTGCTGAAGAACTCTTTGCCCGGAAATTTAATGCTCTCTTCGCCCAGGGAAACTACTCAGAGGCTGCAAAGGTGGCTGCTAATGCTC

CAAAG - UNI34911 - GGAATCCTTCGTACTCCAGATACCATCCGTCGATTCCAGAGTGTCCCAGCTCAGCCAGGTCAAACGTCACCTCTACTTCAG

TATTTCGGAATCCTTTTGGACCAGGGCCAGCTGAACAAATACGAGTCCTTAGAGTTATGTAGACCTGTACTTCAGCAAGGGCGGAAACAGCTTTTGGAGA

AATGGCTGAAAGAAGATAAG - UNI34911 - CTGGAATGTTCTGAAGAACTGGGTGATCTCGTTAAATCTGTGGACCCAACATTAGCACTGAGTGTT

TACCTCAGGGCCAATGTACCTAATAAAGTCATCCAGTGCTTTGCAGAGACAGGCCAAGTCCAGAAGATTGTTTTATATGCTAAAAAA - UNI34911 -

 GTTGGCTATACTCCAGACTGGATCTTTCTCCTGAGAAATGTCATGCGGATCAGTCCAGATCAAGGACAGCAGTTTGCTCAAATGTTAGTTCAGGATGAA

GAGCCTCTTGCTGATATCACCCAG ATTGTGGATGTCTTTATGGAATACAATCTAATCCAACAATGTACTGCCTTCTTACTTGATGCTTTGAAGAATAAT

CGTCCCTCTGAAGGTCCTTTGCAGACGCGATTGCTTGAGATGAACCTTATGCACGCACCTCAA - UNI4754 - GTTGCAGATGCCATTCTCGGGAAT

CAGATGTTCACCCACTATGACCGGGCTCATATCGCCCAGCTGTGTGAGAAGGCGGGCCTGCTGCAGCGTGCATTAGAACACTTCACCGATTTATATGACA

TAAAACGTGCAGTTGTTCATACCCATCTTCTTAACCCTGAG TGGTTAGTGAATTACTTTGGGTCCTTATCAGTTGAAGATTCCCTAGAATGCCTCAGAG

CCATGCTGTCAGCTAATATTCGTCAAAATCTACAGATCTGTGTTCAGGTGGCTTCTAAATATCACGAACAGCTGTCAACTCAGTCTCTGATTGAGCTCTT

TGAATCATTCAAGAGTTTTGAAG - UNI2052 - GTCTCTTTTATTTTCTGGGGTCCATTGTTAACTTTAGTCAGGACCCAGATGTGCACTTTAAATA

TATTCAGGCGGCTTGCAAGACTGGGCAAATCAAAGAAGTGGAAAGAATCTGCAGAGAAAGCAACTGCTATGATCCCGAGCGAGTCAAGAATTTTCTCAAG

 - UNI2052 - GAGGCAAAACTAACAGATCAGTTGCCACTTATCATTGTCTGTGATCGGTTTGACTTTGTCCATGACCTGGTGCTGTATTTATATAGA

AACAATCTTCAGAAGTATATAGAGATATATGTCCAGAAG GTAAATCCAAGTCGACTTCCTGTGGTTATTGGAGGATTGCTGGATGTTGACTGCTCTGAA

GATGTCATTAAAAATTTGATTCTTGTTGTGAGAGGTCAATTCTCTACTGATGAGCTTGTTGCTGAAGTCGAGAAAAGAAACAG ATTGAAGCTGCTTCTT

CCTTGGCTTGAGGCCAGAATTCATGAGGGCTGTGAGGAGCCTGCTACTCACAATGCACTTGCCAAAATATACATTGACAGTAACAACAACCCAGAGAGAT

TTCTTCGTGAAAACCCTTATTATGACAGTCGTGTTGTTGGGAAGTACTGTGAGAAGAGAGACCCCCATCTGGCTTGTGTTGCTTATGAACGTGGCCAGTG

TGACCTGGAGCTCATCAAT GTTTGCAATGAGAATTCCCTCTTCAAAAGCCTTTCTCGCTACTTAGTCCGTCGAAAGGATCCAGAATTGTGGGGTAGTGT

GCTACTGGAAAGCAATCCATACAGAAGACCGTTAATTGACCAG GTTGTACAGACAGCCTTGTCTGAAACTCAGGACCCAGAAGAAGTGTCAGTAACTGT

GAAGGCTTTTATGACAGCAGATCTTCCTAATGAGCTCATTGAACTGCTGGAGAAAATCGTTCTTGATAACTCCGTATTCAGTGAGCACAG GAATCTGCA

AAATCTCCTCATCCTCACTGCAATTAAGGCTGACCGAACACGTGTTATGGAGTATATTAACCGCCTGGATAATTATGATGCTCCAGATATTGCCAACATT

GCCATCAGCAATGAGCTGTTTGAAGAGGCATTTGCTATTTTCCGGAAGTTTGATGTCAATACTTCAGCAGTGCAG - UNI15503 - GTGTTGATTGA

ACATATTGGAAACCTGGATCGTGCATATGAGTTTGCTGAACGCTGCAATGAGCCTGCTGTTTGGAGTCAACTTGCAAAAGCTCAGTTGCAGAAAGGAATG

GTGAAGGAAGCCATTGATTCTTACATCAAAGCAGATGATCCTTCATCTTACATGGAAGTTGTCCAGGCTGCCAATGCCAGCG - UNI15503 - GAAA

CTGGGAAGAATTGGTGAAGTATTTGCAGATGGCACGCAAGAAGGCTCGAGAGTCCTATGTGGAGACAGAATTGATATTTGCACTGGCTAAAACAAACCGC

CTTGCAGAATTAGAAGAGTTCATCAATGGGCCAAATAATGCTCATATTCAGCAA - UNI15503 - GTTGGTGACCGTTGTTATGATGAAAAAATGTA

TGATGCTGCTAAGTTGTTGTACAATAATGTTTCTAACTTTGGACGCTTGGCATCTACCCTTGTTCACCTTGGCGAGTATCAGGCAGCAGTTGATGGTGCC

AGAAAAGCTAATAGTACTCGAACATGGAAAGAG GTCTGCTTTGCCTGTGTAGATGGGAAAGAGTTCCGCCTTGCTCAGATGTGTGGACTCCATATTGTG

GTGCATGCAGATGAATTAGAGGAGCTTATCAACTACTATCAG GATCGTGGATATTTTGAAGAACTCATCACCATGTTGGAGGCAGCCTTGGGACTGGAG

CGAGCTCACATGGGAATGTTCACAGAGCTAGCTATTTTGTATTCTAAATTCAAGCCACAGAAAATGAGAGAACACCTGGAGTTGTTCTGGTCGAGAGTGA

ATATTCCTAAG - UNI7641 - GTGCTGAGAGCTGCAGAACAGGCTCATCTCTGGGCAGAGCTGGTGTTTCTGTATGACAAGTACGAAGAGTATGACA

ATGCCATCATTACCATGATGAATCACCCCACCGATGCATGGAAGGAAGGGCAGTTCAAAGACATCATCACCAAG GTGGCTAATGTGGAACTGTACTACA

AAGCAATCCAGTTCTACTTAGAATTCAAGCCTTTGTTGTTAAATGACTTGCTCATGGTGCTGTCTCCACGGTTGGATCACACTCGTGCAGTCAATTATTT

CAGCAAG GTAAAACAGCTACCACTGGTGAAACCATATTTACGCTCAGTGCAGAACCACAACAACAAATCTGTGAATGAATCACTGAACAACCTCTTTAT

TACTGAAGAAGATTACCAG GCTCTGCGAACATCAATAGATGCTTATGACAACTTTGACAACATCTCACTTGCTCAGCGTTTGGAAAAACACGAACTCAT

TGAATTCAGAAGAATTGCTGCTTATCTCTTCAAAGGCAACAATCGCTGGAAACAGAGTGTAGAGTTGTGCAAGAAAGACAGCCTTTACAAG GATGCAAT

GCAGTATGCCTCTGAATCTAAAGACACAGAATTGGCTGAAGAGCTCCTACAGTGGTTTTTGCAGGAAGAAAAAAGAGAATGCTTTGGAGCTTGTCTCTTT

ACCTGTTATGATCTCTTAAGGCCAGATGTCGTCCTGGAAACCGCATGGAGACATAATATCATGGATTTCGCCATGCCCTATTTCATCCAGGTCATGAAGG

AATATTTGACCAAG GTGGATAAATTAGATGCTTCGGAGTCGCTGAGAAAAGAAGAAGAACAAGCTACAGAGACACAGCCCATTGTTTATG GTCAGCCC

CAGCTGATGCTAACAGCAGGACCCAGTGTGGCAGTCCCTCCCCAGGCACCTTTTGGTTATGGTTATACTGCACCACCGTATGGGCAGCCACAGCCTGGCT

TTGGGTACAGCATGTGA
Translation
MAQILPIRFQEHLQ - UNI4112 - - UNI18758 - - UNI21410 - - UNI29524 - LQNLGINPANIGFSTLTMESDKFICIREKVGEQA

QVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKA - UNI5782 - - UNI18758 - - UNI21410 - - UNI29524 - AGKTLQIFNIEM

KSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQ QNRVVGAMQLYSVDRKVSQPI

EGHAASFAQFKMEGNAEESTLFCFAVRGQAGGK - UNI28000 - LHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQ - UNI28000 - I

SEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQ VLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFA

RKFNALFAQGNYSEAAKVAANAPK - UNI34911 - GILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKW

LKEDK - UNI34911 - LECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKK - UNI34911 - VGYTPDWIFLLRNVMR

ISPDQGQQFAQMLVQDEEPLADITQ IVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQ - UNI4754 - VADAILGNQMFTHYD

RAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPE WLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSF

EG - UNI2052 - GLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLK - UNI2052 - EAKLTDQLPLIIVCDRF

DFVHDLVLYLYRNNLQKYIEIYVQK VNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNR RLKLLLPWLEARIHEGCEEPATHNA

LAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELIN VCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQ VVQ

TALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHR RNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRK

FDVNTSAVQ - UNI15503 - VLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASG - UNI15503 

- GNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ - UNI15503 - VGDRCYDEKMYDAAKLLYNNVSNFGRLASTL

VHLGEYQAAVDGARKANSTRTWKE VCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQ DRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKP

QKMREHLELFWSRVNIPK - UNI7641 - VLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITK VANVELYYKAIQFYLEFK

PLLLNDLLMVLSPRLDHTRAVNYFSK VKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQ ALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAY

LFKGNNRWKQSVELCKKDSLYK DAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTK VD

KLDASESLRKEEEQATETQPIVYG GQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
Transcript ENSMUST00000100663
Sequence
TTGCGGCTCTCCCGGCCCCTGGAGCCTCCGCCCCCGACCCAAGCTCTCTCGTCTGCCTGCCAGTTCCCTGCGTCCCCGGAGAGTATCCCTCTGAGCCCAG

CCTCCCCTCCCCTTCCCCGTCTCCTCCTCTCCCTTGGAGAGCCCGGGCAGGCACTGCCCTGCAGCCCCAGTGACAGGAGGAGACCATACTCCCCGACAGC

GCCATGGCCCAGATTCTGCCCATTCGCTTTCAGGAGCATCTCCAG - UNI4112 - - UNI18758 - - UNI21410 - - UNI29524 - CTC

CAGAACCTGGGTATCAACCCAGCAAACATTGGCTTCAGTACCTTGACTATGGAGTCAGACAAATTCATCTGCATTAGAGAAAAAGTGGGAGAGCAGGCCC

AGGTGGTAATCATTGATATGAATGATCCAAGTAATCCAATTCGAAGACCAATCTCAGCAGACAGTGCCATCATGAATCCTGCCAGCAAAGTGATTGCACT

GAAAG - UNI5782 - - UNI18758 - - UNI21410 - - UNI29524 - CTGGCAAAACTCTTCAGATATTTAACATTGAAATGAAAAGTAA

AATGAAGGCCCATACCATGACTGATGATGTCACCTTCTGGAAATGGATCTCTTTGAATACGGTTGCTCTTGTTACGGATAATGCAGTTTATCACTGGAGT

ATGGAAGGAGAGTCTCAGCCAGTGAAAATGTTTGATCGTCATTCTAGCCTCGCAGGATGCCAGATCATCAATTACCGTACAGATGCAAAGCAGAAATGGT

TGCTTCTCACTGGCATATCTGCACAG CAAAATCGTGTGGTTGGAGCTATGCAGCTGTATTCTGTAGATAGGAAAGTTTCTCAGCCTATTGAAGGGCATG

CAGCTAGTTTTGCACAATTTAAGATGGAAGGAAATGCAGAAGAATCAACATTATTTTGTTTTGCTGTGCGGGGTCAGGCAGGAGGAAAG - UNI28000

 - TTACATATCATTGAAGTTGGTACCCCACCCACAGGGAATCAACCCTTCCCAAAGAAGGCAGTGGATGTTTTCTTTCCTCCAGAAGCACAAAATGACT

TTCCTGTTGCAATGCAG - UNI28000 - ATCAGTGAAAAGCATGATGTGGTGTTCTTGATTACCAAGTATGGTTATATTCACCTCTATGATCTTGAG

ACTGGCACGTGCATCTACATGAACAGAATCAGCGGAGAAACCATCTTCGTCACTGCACCTCATGAAGCCACAGCTGGAATAATAGGAGTCAACAGAAAGG

GACAG GTCCTGTCAGTTTGTGTGGAAGAGGAGAACATAATTCCTTATATCACCAATGTCCTACAAAATCCTGACTTGGCTCTGAGAATGGCTGTGCGGA

ACAACTTAGCTGGTGCTGAAGAACTCTTTGCCCGGAAATTTAATGCTCTCTTCGCCCAGGGAAACTACTCAGAGGCTGCAAAGGTGGCTGCTAATGCTCC

AAAG - UNI34911 - GGAATCCTTCGTACTCCAGATACCATCCGTCGATTCCAGAGTGTCCCAGCTCAGCCAGGTCAAACGTCACCTCTACTTCAGT

ATTTCGGAATCCTTTTGGACCAGGGCCAGCTGAACAAATACGAGTCCTTAGAGTTATGTAGACCTGTACTTCAGCAAGGGCGGAAACAGCTTTTGGAGAA

ATGGCTGAAAGAAGATAAG - UNI34911 - CTGGAATGTTCTGAAGAACTGGGTGATCTCGTTAAATCTGTGGACCCAACATTAGCACTGAGTGTTT

ACCTCAGGGCCAATGTACCTAATAAAGTCATCCAGTGCTTTGCAGAGACAGGCCAAGTCCAGAAGATTGTTTTATATGCTAAAAAA - UNI34911 - 

GTTGGCTATACTCCAGACTGGATCTTTCTCCTGAGAAATGTCATGCGGATCAGTCCAGATCAAGGACAGCAGTTTGCTCAAATGTTAGTTCAGGATGAAG

AGCCTCTTGCTGATATCACCCAG ATTGTGGATGTCTTTATGGAATACAATCTAATCCAACAATGTACTGCCTTCTTACTTGATGCTTTGAAGAATAATC

GTCCCTCTGAAGGTCCTTTGCAGACGCGATTGCTTGAGATGAACCTTATGCACGCACCTCAA - UNI4754 - GTTGCAGATGCCATTCTCGGGAATC

AGATGTTCACCCACTATGACCGGGCTCATATCGCCCAGCTGTGTGAGAAGGCGGGCCTGCTGCAGCGTGCATTAGAACACTTCACCGATTTATATGACAT

AAAACGTGCAGTTGTTCATACCCATCTTCTTAACCCTGAG TGGTTAGTGAATTACTTTGGGTCCTTATCAGTTGAAGATTCCCTAGAATGCCTCAGAGC

CATGCTGTCAGCTAATATTCGTCAAAATCTACAGATCTGTGTTCAGGTGGCTTCTAAATATCACGAACAGCTGTCAACTCAGTCTCTGATTGAGCTCTTT

GAATCATTCAAGAGTTTTGAAG - UNI2052 - GTCTCTTTTATTTTCTGGGGTCCATTGTTAACTTTAGTCAGGACCCAGATGTGCACTTTAAATAT

ATTCAGGCGGCTTGCAAGACTGGGCAAATCAAAGAAGTGGAAAGAATCTGCAGAGAAAGCAACTGCTATGATCCCGAGCGAGTCAAGAATTTTCTCAAG 

- UNI2052 - GAGGCAAAACTAACAGATCAGTTGCCACTTATCATTGTCTGTGATCGGTTTGACTTTGTCCATGACCTGGTGCTGTATTTATATAGAA

ACAATCTTCAGAAGTATATAGAGATATATGTCCAGAAG GTAAATCCAAGTCGACTTCCTGTGGTTATTGGAGGATTGCTGGATGTTGACTGCTCTGAAG

ATGTCATTAAAAATTTGATTCTTGTTGTGAGAGGTCAATTCTCTACTGATGAGCTTGTTGCTGAAGTCGAGAAAAGAAACAG ATTGAAGCTGCTTCTTC

CTTGGCTTGAGGCCAGAATTCATGAGGGCTGTGAGGAGCCTGCTACTCACAATGCACTTGCCAAAATATACATTGACAGTAACAACAACCCAGAGAGATT

TCTTCGTGAAAACCCTTATTATGACAGTCGTGTTGTTGGGAAGTACTGTGAGAAGAGAGACCCCCATCTGGCTTGTGTTGCTTATGAACGTGGCCAGTGT

GACCTGGAGCTCATCAAT GTTTGCAATGAGAATTCCCTCTTCAAAAGCCTTTCTCGCTACTTAGTCCGTCGAAAGGATCCAGAATTGTGGGGTAGTGTG

CTACTGGAAAGCAATCCATACAGAAGACCGTTAATTGACCAG GTTGTACAGACAGCCTTGTCTGAAACTCAGGACCCAGAAGAAGTGTCAGTAACTGTG

AAGGCTTTTATGACAGCAGATCTTCCTAATGAGCTCATTGAACTGCTGGAGAAAATCGTTCTTGATAACTCCGTATTCAGTGAGCACAG GAATCTGCAA

AATCTCCTCATCCTCACTGCAATTAAGGCTGACCGAACACGTGTTATGGAGTATATTAACCGCCTGGATAATTATGATGCTCCAGATATTGCCAACATTG

CCATCAGCAATGAGCTGTTTGAAGAGGCATTTGCTATTTTCCGGAAGTTTGATGTCAATACTTCAGCAGTGCAG - UNI15503 - GTGTTGATTGAA

CATATTGGAAACCTGGATCGTGCATATGAGTTTGCTGAACGCTGCAATGAGCCTGCTGTTTGGAGTCAACTTGCAAAAGCTCAGTTGCAGAAAGGAATGG

TGAAGGAAGCCATTGATTCTTACATCAAAGCAGATGATCCTTCATCTTACATGGAAGTTGTCCAGGCTGCCAATGCCAGCG - UNI15503 - GAAAC

TGGGAAGAATTGGTGAAGTATTTGCAGATGGCACGCAAGAAGGCTCGAGAGTCCTATGTGGAGACAGAATTGATATTTGCACTGGCTAAAACAAACCGCC

TTGCAGAATTAGAAGAGTTCATCAATGGGCCAAATAATGCTCATATTCAGCAA - UNI15503 - GTTGGTGACCGTTGTTATGATGAAAAAATGTAT

GATGCTGCTAAGTTGTTGTACAATAATGTTTCTAACTTTGGACGCTTGGCATCTACCCTTGTTCACCTTGGCGAGTATCAGGCAGCAGTTGATGGTGCCA

GAAAAGCTAATAGTACTCGAACATGGAAAGAG GTCTGCTTTGCCTGTGTAGATGGGAAAGAGTTCCGCCTTGCTCAGATGTGTGGACTCCATATTGTGG

TGCATGCAGATGAATTAGAGGAGCTTATCAACTACTATCAG GATCGTGGATATTTTGAAGAACTCATCACCATGTTGGAGGCAGCCTTGGGACTGGAGC

GAGCTCACATGGGAATGTTCACAGAGCTAGCTATTTTGTATTCTAAATTCAAGCCACAGAAAATGAGAGAACACCTGGAGTTGTTCTGGTCGAGAGTGAA

TATTCCTAAG - UNI7641 - GTGCTGAGAGCTGCAGAACAGGCTCATCTCTGGGCAGAGCTGGTGTTTCTGTATGACAAGTACGAAGAGTATGACAA

TGCCATCATTACCATGATGAATCACCCCACCGATGCATGGAAGGAAGGGCAGTTCAAAGACATCATCACCAAG GTGGCTAATGTGGAACTGTACTACAA

AGCAATCCAGTTCTACTTAGAATTCAAGCCTTTGTTGTTAAATGACTTGCTCATGGTGCTGTCTCCACGGTTGGATCACACTCGTGCAGTCAATTATTTC

AGCAAG GTAAAACAGCTACCACTGGTGAAACCATATTTACGCTCAGTGCAGAACCACAACAACAAATCTGTGAATGAATCACTGAACAACCTCTTTATT

ACTGAAGAAGATTACCAG GCTCTGCGAACATCAATAGATGCTTATGACAACTTTGACAACATCTCACTTGCTCAGCGTTTGGAAAAACACGAACTCATT

GAATTCAGAAGAATTGCTGCTTATCTCTTCAAAGGCAACAATCGCTGGAAACAGAGTGTAGAGTTGTGCAAGAAAGACAGCCTTTACAAG GATGCAATG

CAGTATGCCTCTGAATCTAAAGACACAGAATTGGCTGAAGAGCTCCTACAGTGGTTTTTGCAGGAAGAAAAAAGAGAATGCTTTGGAGCTTGTCTCTTTA

CCTGTTATGATCTCTTAAGGCCAGATGTCGTCCTGGAAACCGCATGGAGACATAATATCATGGATTTCGCCATGCCCTATTTCATCCAGGTCATGAAGGA

ATATTTGACCAAG GTTGATGCAATAAAGGAAAAG GTGGATAAATTAGATGCTTCGGAGTCGCTGAGAAAAGAAGAAGAACAAGCTACAGAGACACAGC

CCATTGTTTATG GTCAGCCCCAGCTGATGCTAACAGCAGGACCCAGTGTGGCAGTCCCTCCCCAGGCACCTTTTGGTTATGGTTATACTGCACCACCGT

ATGGGCAGCCACAGCCTGGCTTTGGGTACAGCATGTGAGATGGAAGCTGATCCTGTAGTCTCCTATTTTCATACTGAAGCATCCTCTACCCACTTCTCAG

TTTATAAACGGGGAAACAGGCAACGTGTTCTTGTAACCTTTACTTCATGAAGGACTACTTTTTTGTTCTAACTATAGACTTGGGTCGCCTATGTTAAAAC

TTTATTTTCACATTCCGCATCATTAGACCTTCTTTTCAAAGGGGAATAGTATTCATGTGGGCTTTTTTCTCCCCCTCATTCTTTGAAGAACTGCTTACTA

TTCAATCTATTGTGAAGAACCTGATTTGCACTCTGTAGTGTTTAAAGAAACAAAGAAACTCTAATATTGAATCTCTTAAATTTAGTGTATGTAAACAGCT

TTCACTATGTATTGTCTAAATGCATTTAAATCTCTTTTATTCAAAGAAAAGCTAAGGTGAAAATACTGGTATGTGACCATGCAAGACTGTCAATGCCGAC

AAAGACAACACTAATCAGCATATCCTATATTGGATCACAGTGCTCTCCAAATTATTTGAAAAATGCATACAGACAACTTGCCTGATTGTTTTTTTTTTTT

TTTAATGAGTATAAAAGGCCCTTTCACCTATGCAGGTTTCCCCATTATGCATATAGAAAATGCTAGTGTGTGTTGCTCACTTCATGTGTAACAGGTGTCC

TCATGTTGTGCTGTATCCTGTGCTTTTTCTGTGGGACCATTCCATTCAGGAACAAGAAGCACCATGATTCCACGCGTGTGTATTTACTAACCCTCCCTTC

CCTGAGGTTTGTGTATGTTGGATATTGTGGTGTTTTAGATCACTGAGTGTACAGAAGAGAGAATTCAAACAAGATATTGCTGTTCTTCAGTTTTGTTTGT

GGAATTTGAAATTACTCCAATTTAAAATAAATTACTGGACTGTGG
Translation
 - UNI4112 - - UNI18758 - - UNI21410 - - UNI29524 -  - UNI5782 - - UNI18758 - - UNI21410 - - UNI2952

4 -   - UNI28000 -  - UNI28000 -   - UNI34911 -  - UNI34911 -  - UNI34911 -   - UNI4754 -   - UNI205

2 -  - UNI2052 -       - UNI15503 -  - UNI15503 -  - UNI15503 -    - UNI7641 -  MVLSPRLDHTRAVNYFSK V

KQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQ ALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYK DAMQY

ASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTK VDAIKEK VDKLDASESLRKEEEQATETQP

IVYG GQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM

For any suggestions or comments, please send an email to unitrap@crg.es