Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047193 (Dync2h1)
Chromosomal location
Chr 9: 6928503 - 7177046 (-)
Description
dynein cytoplasmic 2 heavy chain 1 Gene [Source:MGI Symbol;Acc:MGI:107736]
RefSeq_dna
NM_029851 
RefSeq_peptide
NP_084127.2 
UniGene
Mm.237596 Mm.402863 Mm.407245 
MGI
MGI:107736 
Uniprot/SWISSPROT
Q45VK7 
Human Ortholog
ENSG00000187240 (DYNC2H1)
Omim not available
UniTrap UNI7791
Vector Insertion
Chr 9: 7158033 - 7158828
Public Clones RRM278 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32228
Vector Insertion
Chr 9: 7084933 - 7101188
Public Clones IST13291A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048417
Sequence
GCGGTCGCCATAGCGACGGAGCTTGGCAACTGCTGAGTGTAGTGGTGAAGGCACTGAACCTCTCCAGGTCCCTTTCTGTCTCCGCGGCCATGGCGGGAAG

CCTCGGAGATGTCCGCAAACTCTTTCTTTTTACGACCACCCAGAATTACTTCGGGCTGAGACCGGAGCTCTGGGATCAGCCTCCGTTGAGCAACTGCCCG

GAGGTGAACAACTTCTTGGACGACGGGAACCAGATGCTACTTCGGGTGCAGCGGTCCGAAGCTGGGCTGGCCTTTTCCAACACG ATTGATTTTGATGAC

GCAAAAGACAAAGTGCTGGTGTTTTTCAAGCTCCGACCAGAAGTAATTACAGATGGCAATCTGCATAACAACATTCTGGTTTCTTCTATGCTGGAATCAC

CTATCAACTCCCTTTACCAAGCAGTACGACAGGTGTTTGCACCCATGTTGCTGAAG GACCAGGAATGGAGCAGAAACTTTGATCCTAAACTTCAGAATC

TTTTGAGTGAACTAGAAGCTGGATTGGGTATAGTCCTACGAAAATCAGATACTAACTTACCCAAGCTGAAACTTAAGGAAGACGATACTAGAG GTATTC

TCACACCAAGTGATGAGTTCCAGTTTTGGATAGAACAAGCTCATCGTGGAAGCAAACAGATTAGTAAAGAAAGAGCCAGTTATTTTAAGGAATTATTTGA

AACAATTTCAAGG GAATTTTATAACTTGGACAGTCTGTCCTTGCTAGAAGTTGTTGACTTGGTGGAGACAACTCGGGATGTTGTAGATGATGTGTGGCG

ACAGACAGAGCATGATCATTACCCTGAGTCACGTATGCTGCATCTCCTGGATGTCATAG GTGGTTCATTTGGAAGGTTTGTTCAGAAAAAATTAGGAAG

CTTGAAACTGTGGGAAGATCCTTATTATCTCGTGAAAGAAAACCTTAAAGCTGGCATTTCAATTTGTGAACAATGGGTGATAGTCTGCAGTCACCTCACA

GGTCAGGTGTGGCAGCGCTATGTCCCTCATCCATGGAAAAGTGGAAAGTATTTCCCAGAAACTCTTGACAAACTGGGCAAACGGCTAGAGGAG GTCTTG

GCTATTCGAACAATTCATGAGAAGCTCTTGTACTTTTTACCTGCCAGTGAGGAGAGAATTGTATGCCTGTCTCGGGTATTTGAGCCTTTCACTGGTGTGA

ACCCCGTGCAGTACAATCCTTATACTGAG CCTTTATGGAAAGCTGCAGTGTCTCAGTATGAAAAGATCATTGCACCTGCAGAACAGAAAATAGCAGGGA

AATTAAAGAATTATATTTCAGAAATTCAAGATAGTCCACAGCAG CTTCTCCAAGCATTTCTAAAATACAAAGAATTGGTGAAGCGTCCCACTATAAGCA

AAGAACTGATGTTAGAGAGAGAGACTTTACTGGCAAGACTTGGGGATTCAGCTAAAG ATTTTCGATTGGACTTTGAGAATCGATGCCGAGGAATTCCTG

GTGATCCATCTGGACCACTTTCTGGCAAAAATCTTTCAGAAGTTGTGAATAATATTGTTTGGGTTCGTCAGTTGGAATTGAAG GTAGACGATACTATCA

AGATAGCAGAAGCTCTTTTGTCTGACTTGTCAGGATTTCGATCTTTTCATCGGAGTGCTGAAGATCTCTTGGACCAGTTCAAGCTCTATGAACAGGAACA

GTTTGATGACTGGTCAAGAGAAGTCCAGTCAGGGTTGTCTGACTCCAGGTCAGGTCTGTG TATTGAGGCTAACAGCCGAATAATGGAATTGGATCCTAA

TGATGGGGCATTAAAAGTGCATTATTCTGATCGCCTGGTGATTCTTCTGAGAGAAGTCCGTCAGCTTTCTGCCCTGGGCTTTGTCATTCCTGCAAAAATA

CAGCAGGTTGCAAATGTTGCTCAGAAGTTCTGCAAGCAAGCCATCATTCTTAAGCAA GTGGCACATTTTTACAATTCCATTGATCAACAGATGATTCAG

AGTCAGAGGCCAATGATGCTGCAGTCTGCCTTAGCATTTGAACAGATAATTAAA AATTCAAAAGCAGGGAGTGGAGGCAAGTCACAGATTACTTGGGAC

AACCCTAAAGAACTAGAAGGCTACATCCAGAAACTACAAAATGCTGCTGAGCGACTTGCCACAGAGAATAGAAGACTGAGAAAGTGGCACACTACATTTT

GTGAAAAG GTTGTCATTCTTATGAATATTGATCTGCTTCGGCAGCAGCAGCGTTGGAAGGATGGACTGCAGGAACTGAGAACTGGCTTAGCGACTGTGG

CAGCGCAG - UNI7791 - GGCTTCCAAGCCAGTGACATGCGTGCGTGGCGGCAGCACTGGAACCACCAGCTTTACAAGGCGCTGGAGCACCAGTATC

AAGTGGGTCTGGAGGCGCTCAACGAGAACCTGCCGGAGATCAACGTAGACTTAACCTACAA ACAGGGAAGGTTACAGTTTCGGCCTCCTTTTGAAGAAA

TCCGGGCTAAATATTACAGAGAAATGAAGAGGTTCATCGGAATTCCCAATCAGTTTAAGGGCGTGGGTGAGGCTGGAGATGAATCAATATTTTCTGTCAT

GATTGATAGAAATGCAAGTGGATTTCTGACTATTTACAGCAAAGCAGAAGATCTGTTTAGAAGACTGTCAGCAGTTTTGCATCAACATAAG GAATGGGT

TGTGATTGGACAGGTTGACATGGAAGCTCTGGTTGAAAAGAATCTTTCTACTGTGCATGATTGGGAGAAAAATTTTAAAGCATTGAAAATAAAAGGGAAA

GAAGTTGAACGGCTTCCCAG TGCTGTCAAGGTGGACTGTCTGAACATCAACTGCAGCCCTGTGAAGACTGTGATCGATGACCTCATCCAGAAGCTCTTT

GATCTGCTTGTCCTTTCTCTGAAGAAGTCCATCCAGA CTCACATACACGAAATTGATACATTTGTTACTGAGGCTATGAAGGTCTTAACAGTTATACCT

CAGTCTGTGGAAGAAATAGGTGATACAAATGTACAGTATAGCAACCTGCAGGATCGGAGGCCTGAG ATTTTGCCCTTGTTTCAAGAAGCCGAAGACAAA

AACAGGCTTTTGCGTACTGTAGCAGGTGGAGGGGTAGAGACAGTTAGCAATCTGAGAGCCAAGTGGGACAAATTCGAGCTGATGATGGAAAGTCACCAAC

TTATGATTAAAGATCAG ATTGAAGTGATGAAGGGAAATGTGAAGTCCCGCCTTCAGATCTATTACCAAGAGCTGGACAAGTTCAAGGCTCGCTGGGACC

AGCTGAAACCTGGGGATGATATTATTGAAACTGGTCAACAAAATACCATGGATCAAAGTGCAAAGTCTATAAAGGAAAAAAAAATTGAGTTTGATGATCT

GGAAGTCATAAGAAAAAAGCTAGT TGATGACTGCCATCATTTTGGACTAGAAGAGCCTAACTTCTCTCTGGCATATAGCATCTCTAAGGACATTGAGAG

CTGTGCACAGATTTGGGCTCTTTATGAGGAGTTCCAACAAGGGCTCCAGGATATGGCCAAAGAAGATTGGATTACTTACCG GGCTAAGATCTACCTGTT

TGAGGAGTTTTTGATTAACTGGCATGAGAGACTAAGGAAGATTGAAGAGCATTCGGTTATGACAGTGAAGTTGCAGTCAGAAGTGGACAGATACAAA AT

GATTATTCCTATCCTGAAATATGTGCGAGGGGAGCATCTTTCTCCAGACCACTGGCTTGACCTTTTTCGTCTACTTGGCCTTCCTCGAGGGACTAGTCTA

GAGAAACTGCTGTTTGGTGACCTGCTCAGAGTTGCTGATACAATTGTGGAGAAAGCATCAGAGCTTAAA GATTTAAATAGTCGGGCACAAGGGGAAGTT

ACCATCAGAGAAGCTTTGCGTGAACTTGATCTATGGGGAGTTGGAGCAGTGTTCTCACTGATTGATTATGAAGACAGCCAGAATCACACTATCAAGCTGA

TTAAAGACTGGAAAGACATAGTGAACCAGGTTGGAGATAATAGATGCCTTCTTCAGTCCTTAAAAGATTCTCCATATTACAAAGGATTTGAAGATAAAGT

ATCAATTTGGGAAAGAAAACTTGCACAGTTAGATGAGTACCTGCAGAATTTGAACCATATCCAGAGAAAATGGGTATATTTGGAGCCCATTTTTGGGCGT

GGAGCTTTGCCTAAAGAACAGACACGCTTCAACAAAGTTGATGAAGACTTCAG ATCAATAATGATGGACATCAGGAAAGACAGTAGAGTCACCACATTG

ACTACTCATGCAGGAATCAGAAACACTCTGCTAACGATACTTGATCAGCTTCAAAGATGCCAGAAATCCCTAAATGAATTTTTGGAG GAAAAACGGTCA

GCATTCCCGAGATTTTATTTTATTGGTGATGATGACTTGTTAGAAATCCTGGGCCAGTCAACTAACCCATCAGTGATTCAGTCTCATCTGAAGAAGCTGT

TTGCTG GCATTAACAGTGTGTGCTTTGATGAGGAATCTAAACATATAACTGCAATGAAGTCACTAGAGGGAGAAGTTGTACCTTTTAAAAGTAAAGTTC

TCCTATCAAATAATGTAGAG GCATGGTTGAATGATCTGGCTTTGGAAATGAAGCAAACTCTGAAACAGTTGTTGAAAGAATGTGTTACTGCTGGACGAA

GTTCACAAGGTGCAATTGACCCATCTCTGTTCCCTTCCCAG ATACTGTGTTTGGCAGAGCAGATCAAGTTTACTGAAGATGTAGAAAATGCCATCAAAG

ACCACAGTCTTCACCAGATTGAAGCACAACTGGTGGCTAAGTTAGAGCGCTACACTAGTGTTGACACAAGCTCTGAGGACCCAGGGAACTCGG AATCAG

GAATTCTGGAGCTTAAGCTGAAAGCACTAATTCTTGATATTATTCATAATATTGATATTGTGAAGCAACTAAACCAAGTTCAAGTTCATACAACTGATGA

CTGGGCTTGGAAGAAACAAGTGAGATTCTACATGAAGAGTGACCATACATGCTATGTTCAAATGGTGGACTCTGAACTGCAGTATACATACGAGTACCAG

 GGTAACGCGCCCAAGCTGGTTTATACTCCACTGACAGACAAATGCTACCTGACTCTCACTCAAGCCATGAAGATGGGACTCGGAGGGAATCCCTATGGA

CCTGCTGGGACTGGAAAAACTGAGTCAGTAAAGGCACTAGGTGGACTTCTTGGGAGACAAGTTTTAGTTTTTAACTGTGATGAG GGCATTGATGTGAAG

TCAATGGGGCGGATATTTGTTGGGTTGGTAAAGTGTGGGGCCTGGGGCTGCTTTGATGAGTTCAATCGACTGGAAGAAGCTGTCCTGTCAGCCGTTTCCA

TGCAGATCCAGACCATTCAGGACGCTTTGAAGAACCACAGAACTGTGTGTGAGCTGCTTGGAAAAGAG GTAGAAATAAATGCCAATTCTGGAATTTTTA

TCACCATGAATCCTGCTGGAAAAGGTTATGGAGGAAGACAAAAACTTCCAGATAACCTTAAACAGCTTTTCAGACCAGTGGCGATGTCGCGTCCAGACAA

TGATCTCATAGCAGAAGTGATTCTATATTCAGAGGGCTTCAAAGATGCTAAAGAATTAGGCAGGAAATTGGTCGCCATTTTCAACCTATCTAG GGAACT

TTTGACACCTCAGCAGCATTATGATTGGGGGTTGAGAGCTTTGAAGACAGTTCTGAGAGGAAGTGGGAATCTTCTGAGACAGTTGAAGAAAAATAGCACA

AAACAAGATG TTAATGAAAATCACATTGTGGTGCAAGCATTGAGACTTAATACAATGTCAAAATTCACATTTGCTGATTGCACGCGGTTTGATGCACTG

ATTAAAGATGTCTTTCCTGGCATTGACTTTAAAGAAGTAGAATACGACGAACTAAGTTCTGCATTAAAGCAAGTCTTTGAGGAGGCCAATTATGAAGTCA

TACCCAATCAG ATGAAGAAGGCTCTAGAATTATATGAACAGTTGCGCCAGAGAACGGGCGTTGTTATTGTTGGTCCAAGTGGTGCTGGCAAATCTACCC

TTTGGAGAATGTTAAGGGCTGCACTTTGTAAAATTGGCAAAGTAGTAAAACAGTACACTATGAATCCCAAAGCTATGCCCAGACATCAGCTCTTAGGACA

CATTGACATGGATACAAGAGAGTGGTCAGATGGCGTTTTGACAAATAGTGCTCGCCAAGTAGTTCGTGAGCCTCAAG ATGTCAGCTCATGGATAATCTG

TGATGGTGACATTGACCCTGAATGGATAGAATCTCTGAATTCTGTTTTGGATGATAATCGGCTGCTCACCATGCCTAGTGGAGAAAGAATTCAGTTTGGT

CCAAATGTTAACTTTGTATTTGAAACTCATGATTTAAGTTGTGCTTCACCAGCCACAATATCTAGAATGGGAATGATATTTCTTAG TGATGAAGAGACA

GATCTTAACTCTCTCATAAAATCTTGGTTGAGGAATCAGCCTCTTGAATACAGAAGTAATCTTGAAAACTGGATTGGAGATTATTTTTCAAAAGCGTTAC

AGTGGGTTTTAAAGCAG AATGACTATGTGGTGGAGACGAGTCTGGTTGGGACTGTGATGAATGGCTTGTCCCACCTCCATGGATGCAAATACCATGACC

AGTTTATTATTAATCTTATACGAGGACTGGGTGGCAATCTGAATATGAAATCACGTCTGGAGTTTACCAAGGAG GTCTTTAATTGGGCACGGGAGACCC

CTCCAGACTCTCACAGGCCAATGGACACCTACTATGACTGTGACCGAGGACAGTTAGCATCCTACATGCTAAAGAAGCCAGAGAGCCTGACAGCTGATGA

TTTCAGCAATGGCCACATCCTTCCTGTCATTCAGACTCCTGATATGCAGCGAGGTTTAGATTATTTCAAACCCTGGCTAAGTTCAGATACCAAACAGCCA

TTTATTCTGGTGGGACCAGAAGGATGTGGCAAAGG GATGCTGCTCAGGTATGCCTTCTCTCAGCTCCGCTCCACAGAGATTGCCACAATCCACTGCAGT

GCTCAGACTACTTCTCGGCATCTTCTGCAAAAACTGAGCCAGACTTGCATGGTAATCAGTACAAATACTGGTCGAGTATACAGACCAAAAGATTGTGAAA

GACTCGTTTTGTATCTAAAAGATATCAACCTGCCCAAGCTTGATAAGTGGGGGACCAGCACTTTGGTGGCTTTCCTCCAGCAG GTGTTAACATATCAAG

GATTTTATGATGAAAATTTGGAATGGGTTGGTCTGGAGAATATTCAGATTGTAGCTTCCATGTCAGCTGGAGGAAGACTGGGGAGACACAAGCTGACCAC

CAGGTTTACGTCTATTGTCCGTCTTTGTGCCATAGA TTACCCAGAAAGAGAACAGTTACAGACAATCTATGGAGCATATTTGGAAGCAGTTCTGCACAA

AAATCTGAAGAATCATTCTATTTGGGGTTCTTCGTCGAAAATTTATCTCTTAGCAGGCTCTATGGTGCAGGTGTATGAACAG GTGCGGGCCAAATTCAC

AGTGGATGAATACAGCCACTACTTCTTCACTCCCTGCATTCTTACTCAGTGGGTGCTTGGCTTGTTCAGATATGATTTAGAAGGAG GATCCTCTAACCA

TCCATTAGATTACGTGCTGGAAATTGTAGCCTATGAAGCACGGCGCTTGTTTCGGGACAAAATTGTTGGTGTGAAGGAGCTGCATTTGTTTGATAACATT

TTAACTTCAGTCCTCCAAGGAGACTGGGGCTCAGACATCCTGGACAATATGGCAG ATAGTTTCTATGTTACATGGGGAGCCCACCATGTCTCAGGAGGA

AAGACAGCTCCAGGACAGCCTTTACCTCCACACGGGAAACCACTTGGCAAACTGACCTCTGCAGACCTGAAGGATGTCATTAAGAAG GGTCTTATTCAT

TATGGACGAGATAACCAGAATTTAGATATTTTACTCTTCCAAGAAGTCCTGGAATATATGTCGAGGATAGACAGAGTGCTGAGTTTCCCTGGAGGCTCCC

TTCTGTTGGCAGGACGAAGCGGCGTGGGGCGGCGGACTGTCACATCTTTAGTCAGTCACATGCATGGTGCTGTGCTCTTCTCCCCGAAGATCTCCAGGGG

CTACGAGCCGAAGCAGTTCAGAAATGATCTCAAGCAT GTGCTGCAACTTGCAGGAATTGAAGCACAGCAGGTAGTCTTACTTCTTGAGGATTACCAGTT

TGTACATCCCACATTCTTGGAGATGATCAATAGCCTTTTGGCTTCAG - UNI32228 - GCGAGGTTCCTGGACTGTATACTCTGGAAGAATTAGAGC

CTTTGCTATTGCCACTGAAAGATCAAGCTTCTCAGGATGGATTTTTTGGACCAGTCTTCAATTACTTCACATACA - UNI32228 - GAATTCAACAA

AATTTGCATATTGTCTTGATTATGGATTCTGCAAATTTGAACTTCATAGTAAACTGTGAGAGTAATCCAGCTTTGCATAAGAAATGCCAGGTGCTATGGA

TGGAGGGCTGGTCAGACAGCAGTATGAAAAAG - UNI32228 - ATACCAGAAATGTTATTCAGTGAAACAGATGGTGAAGAAAAATATGAAAAAAAA

AGAAAGGATGAAAAGAAAAGAAATTCAG TTGATCCCGACTTTATAAAGTCATTCTTATTAATCCATGAGTCTTGTAAAGCTTATGGGGCCACCCCAAGC

AGGTACATGACCTTTCTGCATGTGTATTCTGCCATCAGCAGCAGCAAGAAGAAGGAGTTACTGAAAAGACAGAGTCATTTACAG GCTGGCGTGTCTAAA

CTAAATGAAGCCAAAGCTCTTGTAGATGAGCTGAACAGAAAGGCTGGCGAGCAGAGTATCCTGCTTCGAATAAAGCAGGATGAAGCGGACTCTGCCCTTC

AGGAGATCACAGTGTCCATGCAG GATGCTAGTGAACAAAAGACAGAACTTGAAAGATTGAAACAGCGAATAGCAGAAGAAGTTGTTAAAATTGAAGAGA

GAAAAAGTAAAATTGATGATGAATTAAAAGAAGTACAA CCTTTAGTCAATGAAGCTAAGCTAGCAGTTGGAAACATTAGGCCGGAATCTCTTTCAGAAA

TCCGCTCACTCCGCATGCCACCAGATGTAATCCGAGACATTCTTGAAGGAGTTTTGAGGTTAATGGGTATCTTTGATACATCATGGGTAAGCATGAAAAG

 CTTCCTTGCAAAAAGGGGTGTGAGAGAAGACATTGCAACTTTTGATGCGCGGAACATTCCTAAGGAGATACGAGAGAGTGTGGAGGAGCTTCTCTTCAA

AAACAAAGCCTCTTTCGATCCAAAG AATGCTAAGCGTGCCAGCACTGCAGCTGCTCCTTTGGCTGCTTGGGTTAAGGCCAATGTACAGTACTCCCATGT

CTTGGAACGGATTCAGCCTCTGGAAACAGAGCAGTCAGGATTAGAATT GAATTTGAAGAAAACTGAAGACAGAAAAAGGAAGCTAGAAGATCTTCTGAA

CTCTGTTGGTCAGAAAGTATCAGAACTCAAAGAAAA ATTTCAGAGCAGGACGTCAGAAGCTGCCAAATTGGAAGCTGAAGTCAGCAAGGCACAGGAGAC

CATCAAAGCTGCAGAGGTCCTCATTAGTCAGCTAGACAGAGAGCACAGGAGATGGAATGCCCAG GTTGCCGAGATAGCTGAAGAATTAGCTACCCTCCC

CAAAAGAGCTCAGCTAGCGGCTGCTTTCATCACCTACCTCTCTGCTGCTCCAGAAGGCCTCAGGAAAAACTGTCTGGAAGAGTGGACCAAGGCAGCTGGT

CTTGAGA AATTTGATCTCAGGCGGTTTCTCTGTACTGAAAGTGAGCAGTTGATCTGGAAAAGTGAGGGCCTTCCATCCGATGACCTTTCCATTGAGAAT

GCCCTTGTGATCTTACAG AGTCGAGTATGCCCATTTCTGATAGATCCATCTTCTCAGGCAACAGAGTGGCTAAAGACACATCTGAAGGACTCACATTTG

GAAGTTATTAACCAACAG GACAGTAACTTTATCACAGCTCTTGAGTTGGCAGTACGTTTTGGGAAAACCCTCATCATACAAGAGATGGACGGGGTAGAG

CCCGTTCTTTATCCGCTGCTGAGACGAGATCTGGTTGCTCAAG GACCTCGGTATGTGGTACAAATAGGTGACAAGATCATTGACTACAATGAAGATTTC

CGCCTTTTCTTGTCAACAAGAAATCCAAATCCCTTTATCCCACCGGATGCCGCATCCATCGTGACTGAGGTGAACTTTACCACAACAAGAAGTGGACTTC

GAGGACAG CTTTTAGCTTTAACCATTCAGCATGAAAAACCTGATCTAGAAGAACAGAAAACAAAGCTATTACAGCAGGAAGAAGATAAGAAAATACAGC

TGGCTAGACTTGAGGAGTCTCTCTTAGAG ACACTTGCCACATCTCAAGGCAATATTTTGGAAAACAAGGATTTGATTGAATCTTTGAATCAGACAAAAG

CAAGCAGTGCTCTTATTCAAGACTCACTTAAGGAATCGTATAAACTCCAGATTTCCCTGGATCAA GAGCGCGATGCCTACTTGCCTCTGGCTGAGAGTG

CCAGCAAGATGTACTTCATCATCTCGGATTTGTCCAAGATTAATAACATGTACCGTTTCAGTTTGGCTTCATTTCTCCGACTTTTTCAGCGAGCTCTCCA

GAACAAGCAG GACTCTGAAAATACAGAAGAAAGAATCCAATGTCTTGTGAACTCACTGAAACACATGGTTTATGAATATATATGCAGGTGCCTGTTTAA

G GCGGACCAGTTGATGTTTGCTTTGCATTTTGTTCGAGGAATGCATCCTGAACTTTTTCAAGAAAAT GAATGGGATACATTCACAGGTGTGGTTGTTG

GAGACATGCTGCGCAAAGCT GACTCTCAACAAAGAATTCGTGATCAGCTTCCATCTTGGATAGATCAAGAAAGGAGCTGGGCAGTGGCAACATTGAAG 

ATCTCCCTCCCTAGTCTCTACCAGACTCTCTGTTTGGAAGATGGGGCATTTTGGCGTACTTACTATCATCACTCAATGTGTGAACAGGAGTTTCCATCAA

TTCTTGCAAAGAAGGTTTCCTTATTTCAGCAG GTTCTTGTAGTTCAGGCTCTGCGGCCAGACAGACTACAGAGTGCCATGGCTCTGTTTGCCTGCAAGG

CTCTGG GGTTGAAGGAGTTATCCCCTCTTCCTCTGAACCTCAAACGCTTATACAAGGAGACCCTCGAGATTGAACCCATTTTGATCATAATCTCTCCAG

GGGCTGACCCTTCTCAGGAACTTCAGGAACTTGCTAGTGCTGAAAGAAGCAGTGAGTGTTATCACCAG GTTGCCATGGGTCAAGGTCAAGCTGATTTAG

CAATTCAGATGCTAAAAGAATGTGCCCGAAATGGAGATTGGCTCTGTTTGAAGAACTTACATCTTGTGGTGTCTTGGCTTCCAGTTCTGGAGAAG GAAT

TGAATACTCTTCAGCCTAAAGACAGCTTTCGTCTGTGGCTCACTGCAGAAGTTCATCCCAACTTTACCCCCATATTACTCCAATCAAGTCTGAAGATAAC

ATATGAG TCACCTCCAGGTTTGAAGAAGAATTTGATGCGCACTTATGAGTCTTGGACTCCTGAGCAAATTAGCAAAAGAGATAACATACACCGAGCTCA

TGCTCTTTTTAGCTTAGCATGGTTTCATGCTGCCTGTCAGGAAAGAAGAAATTATATTCCACAG GGTTGGACCAAGTTTTATGAGTTTTCCTTATCAGA

TCTTCGGGCCGGGTACCATGTCATTGACAGGCTCTTCGATG GTACCAAAGATGTACAGTGGGAATTTGTACACGGCTTACTTGAAAATTCTATTTATGG

AGGACGTGTAGATAACTATTTTGATCTTAGAGTTCTTCAGTCCTACTTGAAGCAGTTTTTTAATTCTTCAATAATTGATGTACTAAACCAAAGGAACAAG

AAAAGCATTTTTCCATATTCCATCTCTCTCCCAAACTCGTGCAGCATTTTG GACTACCGTGCTGTCATCGAGAAGCTCCCCGAGGACGATAAGCCCAGC

TTCTTCGGTCTGCCCGCCAACATTGCCCGCTCCTCTCAGCGCATGATCAGCTCTCAG GTCATCTCCCAGCTCAGGATCTTGGGAAGATCGGTCACAGCC

GGTTGCAAATTTGACAGAGAAATCTGGTCTAATGAACTTTCTCCAGTTCTGAATCTTTGGAAAAAGCTGAACCAG AATTCAAACCTAATTCATCAAAAA

GTATCACCACCTAATGATCGACAAGGATCTCCAATATTATCGTTCATCATTCTTGAGCAGTTCAATGCCATCCGCTTGGTACAAAGTGTTCATCAGTCGC

TTGCTGCCCTCAGCAAAGTCATCAGGGGAACTACTTTACTGAGTTCAGAAGTACAAAAGCTGGCAAGTGCTTTATTAAACCAGAAG TGTCCTCTCACAT

GGCAGAGCAGGTGGGAAGGTCCTGAGGATCCTCTCCAGTACCTTCGTGGCCTCGTAGCCAGAACCCTTGCAATTCAG AATTGGGTAGAGAAAGCTGAAA

AGCAAGTTCTTCTCGCTGATACACTTGACCTATCTGAGCTCTTCCATCCGGACACATTCCTTAATGCTCTTCGCCAGGAAACTGCAAG GGCAACAGGCT

GCTCTGTGGATAGTCTTAAATTTGTAGCATCCTGGAAAGGCCGACTTCAAGAAGCAAAGCTGCAAATTAAG ATCAGTGGCCTGTTACTGGAAGGGTGCA

GTTTTGATGGCAATCGCCTTTCAGAGAACCAGCATGATTCTCCTAGCGTATCGTCAGTTCTTCCTTGCTACATGGGCTGGACTCCACAA GGTTCATATG

GTCCATATTCCCCTGATGAGTGCATCTCTTTGCCTGTTTATACAAGTGCTGAGAGGGAGCGTGTGGTGACCAACATTGATGTTCCCTGTGGTGGTAACCA

GGACCAGTGGATCCAGTGTGGGGCAGCGCTGTTTCTTAAAAATCAGTAGGTCTCAGGCAATACAGGAAGACTTAGCAAAGTGACGATTGCTGCAACACTC

CACACAGAGCATGAAGTCAGTCTGCATTAGGAACGTTAGTTCAATATATCTGCTGTTAGTTGTTCTTGCTGATGGTCTCCTTGTATTTCTATTTTAATAA

ATGTGTAACACCAGCACTGTGTACCTTAAAGAAGTTCATATTACAGTGGGGTATTTGGTGGTAGGTATTAAATATTTTTATGAGGAAGTTTACTCTTCAG

TAGTTTAAATATTTACAATTTAAAGTTCTATATTTAAGAAATATATTTTGGTTTCAAATAATTGCATATAAAGTTATTGTATTCTCCTACAGTTTTAAAT

ATATGTACACACATTAAGCATTGAGCCATGTACAAAAGTATAATGAATGAATTACCTTAACAATTAAACATGATGTCATTTCTTTGTGTACATTAAATGA

TATAATACATATCCTACCAGTAAAGAGGAAGAATATAGATAATGAAACATAAATTCTGTCATAGGATTTAGAGTCACCTTCTTTCTATGTGCTTTGGAAC

TTGTATTTGAGCTCTGCAAGACTCCCTGAAATCCAAGAATGCAGTGGTGTTGCCACTGAGTGACACCTTAGGAGCCTGGATTACATCCAGCTCTCCGTCC

ATGGGAGCAGACAGCTCTTGAGGGTTGAGATGTGTGTTGCTGTTAGGCATGTGCAATAGCCACTCTTAGCTACTGTGTGTGTCTACACTTGGGCCAGTGC

TATCGGGTGTTTGTTGTTTTGTTTTGCACTTCCCCCAGTATCAGGCATGAAATACAGGGTCCAGTGTAAGGTAGGCAAGCACTCTACGACTGAGATACAC

CTCCACACTTGGCATTTACCATCAAAGAAAAGTTGCATACTTAGAGGAGAAATAACAGCTGAAATAAAAGGTAAAAAAGAGACTGTGAATTAAGAATCTC

ACATTAATACT
Translation
MAGSLGDVRKLFLFTTTQNYFGLRPELWDQPPLSNCPEVNNFLDDGNQMLLRVQRSEAGLAFSNT IDFDDAKDKVLVFFKLRPEVITDGNLHNNILVSS

MLESPINSLYQAVRQVFAPMLLK DQEWSRNFDPKLQNLLSELEAGLGIVLRKSDTNLPKLKLKEDDTRG GILTPSDEFQFWIEQAHRGSKQISKERAS

YFKELFETISR EFYNLDSLSLLEVVDLVETTRDVVDDVWRQTEHDHYPESRMLHLLDVIG GGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQ

WVIVCSHLTGQVWQRYVPHPWKSGKYFPETLDKLGKRLEE VLAIRTIHEKLLYFLPASEERIVCLSRVFEPFTGVNPVQYNPYTE PLWKAAVSQYEKI

IAPAEQKIAGKLKNYISEIQDSPQQ LLQAFLKYKELVKRPTISKELMLERETLLARLGDSAKD DFRLDFENRCRGIPGDPSGPLSGKNLSEVVNNIVW

VRQLELK VDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSREVQSGLSDSRSGLC CIEANSRIMELDPNDGALKVHYSDRLVILLRE

VRQLSALGFVIPAKIQQVANVAQKFCKQAIILKQ VAHFYNSIDQQMIQSQRPMMLQSALAFEQIIK NSKAGSGGKSQITWDNPKELEGYIQKLQNAAE

RLATENRRLRKWHTTFCEK VVILMNIDLLRQQQRWKDGLQELRTGLATVAAQ - UNI7791 - GFQASDMRAWRQHWNHQLYKALEHQYQVGLEALN

ENLPEINVDLTYK KQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSVMIDRNASGFLTIYSKAEDLFRRLSAVLHQHK EWVVIGQV

DMEALVEKNLSTVHDWEKNFKALKIKGKEVERLPS SAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQT THIHEIDTFVTEAMKVLTVIPQS

VEEIGDTNVQYSNLQDRRPE ILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFELMMESHQLMIKDQ IEVMKGNVKSRLQIYYQELDKFKARWDQ

LKPGDDIIETGQQNTMDQSAKSIKEKKIEFDDLEVIRKKLV VDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQGLQDMAKEDWITYR RAKI

YLFEEFLINWHERLRKIEEHSVMTVKLQSEVDRYK MIIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASELK DLNSRA

QGEVTIREALRELDLWGVGAVFSLIDYEDSQNHTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEP

IFGRGALPKEQTRFNKVDEDFR RSIMMDIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLE EKRSAFPRFYFIGDDDLLEILGQSTNPSVIQ

SHLKKLFAG GINSVCFDEESKHITAMKSLEGEVVPFKSKVLLSNNVE AWLNDLALEMKQTLKQLLKECVTAGRSSQGAIDPSLFPSQ ILCLAEQIKF

TEDVENAIKDHSLHQIEAQLVAKLERYTSVDTSSEDPGNSE ESGILELKLKALILDIIHNIDIVKQLNQVQVHTTDDWAWKKQVRFYMKSDHTCYVQMV

DSELQYTYEYQ GNAPKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDE GIDVKSMGRIFVGLVKCGAWGCFDEF

NRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKE VEINANSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELG

RKLVAIFNLSR RELLTPQQHYDWGLRALKTVLRGSGNLLRQLKKNSTKQDV VNENHIVVQALRLNTMSKFTFADCTRFDALIKDVFPGIDFKEVEYDE

LSSALKQVFEEANYEVIPNQ MKKALELYEQLRQRTGVVIVGPSGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNS

ARQVVREPQD DVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLS SDEETDLNSLIKSWLRNQ

PLEYRSNLENWIGDYFSKALQWVLKQ NDYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKE VFNWARETPPDSHRPMDTYY

DCDRGQLASYMLKKPESLTADDFSNGHILPVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKG GMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQ

KLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQ VLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLC

AID DYPEREQLQTIYGAYLEAVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQ VRAKFTVDEYSHYFFTPCILTQWVLGLFRYDLEGG GSSNHPLDYV

LEIVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMAD DSFYVTWGAHHVSGGKTAPGQPLPPHGKPLGKLTSADLKDVIKK GLIHYGR

DNQNLDILLFQEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRNDLKH VLQLAGIEAQQVVLLLEDYQFVH

PTFLEMINSLLASG - UNI32228 - GEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYR - UNI32228 - RIQQNLHIVLIMDSANLNF

IVNCESNPALHKKCQVLWMEGWSDSSMKK - UNI32228 - IPEMLFSETDGEEKYEKKRKDEKKRNSV VDPDFIKSFLLIHESCKAYGATPSRYMT

FLHVYSAISSSKKKELLKRQSHLQ AGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITVSMQ DASEQKTELERLKQRIAEEVVKIEERKS

KIDDELKEVQ PLVNEAKLAVGNIRPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKS SFLAKRGVREDIATFDARNIPKEIRESVEELLFK

NKASFDPK NAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLEL LNLKKTEDRKRKLEDLLNSVGQKVSELKEK KFQSRTSEAAKLEAEVSK

AQETIKAAEVLISQLDREHRRWNAQ VAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEK KFDLRRFLCTESEQLIWKSEGLPSD

DLSIENALVILQ SRVCPFLIDPSSQATEWLKTHLKDSHLEVINQQ DSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQG GPRYVVQIGD

KIIDYNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQ LLALTIQHEKPDLEEQKTKLLQQEEDKKIQLARLEESLLE TLATSQGNILENK

DLIESLNQTKASSALIQDSLKESYKLQISLDQ ERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQ DSENTEERIQCLVNSLKH

MVYEYICRCLFK ADQLMFALHFVRGMHPELFQEN EWDTFTGVVVGDMLRKA DSQQRIRDQLPSWIDQERSWAVATLK ISLPSLYQTLCLEDGAFWR

TYYHHSMCEQEFPSILAKKVSLFQQ VLVVQALRPDRLQSAMALFACKALG GLKELSPLPLNLKRLYKETLEIEPILIIISPGADPSQELQELASAERS

SECYHQ VAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEK ELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYE SPPGLKKNLMRT

YESWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQ GWTKFYEFSLSDLRAGYHVIDRLFDG GTKDVQWEFVHGLLENSIYGGRVDNYFDLRVL

QSYLKQFFNSSIIDVLNQRNKKSIFPYSISLPNSCSIL DYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQ VISQLRILGRSVTAGCKFDREIWSN

ELSPVLNLWKKLNQ NSNLIHQKVSPPNDRQGSPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQK CPLTWQSRWEGPED

PLQYLRGLVARTLAIQ NWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETAR RATGCSVDSLKFVASWKGRLQEAKLQIK ISGLLLEGCSFDGNRL

SENQHDSPSVSSVLPCYMGWTPQ GSYGPYSPDECISLPVYTSAERERVVTNIDVPCGGNQDQWIQCGAALFLKNQ

For any suggestions or comments, please send an email to unitrap@crg.es