Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047213 (Ythdf3)
Chromosomal location
Chr 3: 16083250 - 16116852 (+)
Description
YTH domain family 3 Gene [Source:MGI Symbol;Acc:MGI:1918850]
RefSeq_dna
NM_172677 
RefSeq_peptide
NP_766265.2 
UniGene
Mm.415749 Mm.472482 Mm.23834 
MGI
MGI:1918850 
Uniprot/SWISSPROT
Q8BYK6 
Uniprot/SPTREMBL
Q7TN20 Q8BVC6 Q8R5D2 
Human Ortholog
ENSG00000185728 (YTHDF3)
Omim not available
UniTrap UNI1237
Vector Insertion
Chr 3: 16083521 - 16083921
Public Clones DD0975 (sanger) XB476 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29617
Vector Insertion
Chr 3: 16083947 - 16087054
Public Clones E138D10 (ggtc) PST26259-NR (escells) PST18446-NR (escells) IST14935B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7177
Vector Insertion
Chr 3: 16089564 - 16103186
Public Clones RRU446 (baygenomics) RRR024 (baygenomics) RRE217 (baygenomics) IST14238F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16320
Vector Insertion
Chr 3: 16105543 - 16113954
Public Clones not available
Private Clones OST463223 (lexicon) OST366981 (lexicon) OST134530 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050490
Sequence
ATGTTCTATCTTGATTTGACTTTGCTTCATAGGGCAACAGAGGAAACAGGCGAAGAATCAT TTTCAGTACAAAATGGTTCGATTCATCAAAAAGATGCT

GTAAATGATGATGATTTTGAGCCATACTTAAGTAGCCAGACAAATCAG - UNI7177 - AATAACAGCTATCCACCAATGTCAGATCCATATATGCCT

AGTTACTATGCTCCGTCCATTGGATTTCCATATTCTCTTGGGGAAGCAGCATGGTCCACGGCTGGAGATCAGCCTATGCCATATCTGACAACCTATGGAC

AAATGAGTAATGGAGAACATCATTATATACCAGATGGTGTTTTTAGTCAACCAGGGGCATTAGGAAATACCCCTCCATTTCTTGGTCAACATGGATTTAA

CTTTTTTCCTGGTAATGCTGATTTCTCTACATGGGGAACAAGTGGATCTCAGGGACAATCAACACAAAATTCTGCTTATAGTAGCAGTTACGGCTATCCA

CCTAGTTCTCTTGGGAGAGCTATTACTGATGGACAGGCCGGATTTGGCAATGATACTTTGAGTAAGGTGCCTGGCATTAGTAGTATTGAGCAAGGCATGA

CTGGACTGAAAATTGGTGGTGACCTGACAGCTGCGGTGACGAAAACTGTAGGTACAGCCTTGAGCAGCAGTGGTATGACTAGCATTGCAACCAATAATGT

GCCCCCTGTTAGCAGTGCAGCACCTAAACCAACTTCTTGGGCTGCTATTGCCAGAAAGCCTGCAAAACCTCAGCCGAAACTTAAACCCAAGGGCAATGTG

GGAATTGGGGGTTCTGCTGTGCCACCACCTCCTATAAAACACAACATGAATATTGGAACTTGGGATGAAAAGGGGTCAGTGGTAAAGGCTCCACCAACCC

AACCAGTTCTGCCTCCTCAAACTATAATCCAGCAGCCTCAGCCATTAATTCAACCACCACCATTGGTGCAAAGCCAACTGCCTCAACAGCAGCCTCAGCC

ACCACAACCACAGCAGCAACAAGGACCTCAGCCACAGGCCCAGCCTCACCAAGTGCAGTCTCAACAGCCACAGTTGCAGAATCGTTGGGTAGCTCCTCGG

AATAGGGGAACCGGCTTCAACCAGAACAATGGAACAGGCAGTGAAAACTTTGGTTTAGGTGTTGTGCCTGTTAGTGCTTCACCTTCTAGTGTAGAGGTGC

ATCCAGTGCTGGAAAAACTAAAGGCCATAAACAATTATAATCCCAAAGACTTTGATTGGAACCTGAAGAATGGACGTGTGTTTATAATTAAGAGCTATTC

TGAGGATGATATACATCGTTCCATCAAGTACTCTATCTGGTGTAGTACTGAGCATGGTAATAAGCGTTTGGATGCAGCTTATCGTTCCCTGAATGGGAAA

GGCCCACTCTATTTACTCTTCAGTGTGAATGGCAGTGGACATTTTTGTGGAGTGGCTGAAATGAAGTCTGTTGTAGACTATAATGCTTATGCTGGTGTCT

GGTCTCAGGATAAGTGGAAGGGCAAATTTGAAGTTAAATGGATCTTTGTCAAAGATGTTCCCAATAACCAATTACGACATATTCGCTTAGAAAATAATGA

CAACAAACCAGTAACCAATTCAAGGGACACTCAAGAAGTACCCCTAGAAAAAGCAAAGCAAGTGCTTAAAATAATCGCTACTTTCAAGCATACCACCTCA

ATCTTTGATGACTTTGCACATTATGAAAAGCGTCAAGAGGAGGAGGAAGCCATGCGAAGG - UNI16320 - GAGAGAAATAGAAACAAGCAATAACC

ACCGTGTGGAGATGTCCTATTAAAATGACAACACTAATGATGTAGACTCTGGAAATGCCTAATAAGTCAAAGAAGATGTTATTAAAGCTTTTTGTTTTCT

GCTTAAGGTGACATCTTTGAACCCTTTAACATGAAATTGATTCTTCTTGTAATGGTTTTCATCAGCGCATCTGCCCTTATTCTCTCACCAAACACACTTG

AGAACTGTAACTTCATGAAGCACTTTGTGTCCTGAAGCTTTTACCAGTACCTGCTGTCTTTTGTAATTATGCATCCTAGCTAAGGCACAGAAGACTGAAT

GAATTGCAAGGATTCATTAACTCTTGGAATTTGTTAAGTACTAACAGTTATCCATTAGAAGTGGTTCAATGATGTAAGAGTCTCACTGCTTCAATCTTTT

CATTGTCGTAGTTTTTAAATTGTCAATTTTTAGCTATTTGACAGATTAAAAGCAAAATAATCATGCCATATTTAGTCTGGAGTTCAAGTCTGAATGTTTA

TGTGAAAAATTATTGTAGCAAACTTTTAATATGGCAAAGCAACCTTATGCTCTATTTTAGCCAAACAGTACATAATCTAAAATTATATATTAGAACATTT

CCCTTGTCTTCAAACTATTTGATGTAACAAATATGCAGCCTGGTGGGCTTCACCAATTAATGCACATCCCCTCCTCTCCAGTTACATGTACACTGAGAAT

ATGCGTTGGTTTGAGGGATTATTTTGTTTCTACCACTTAATGAATCTCAACATTTTGAGTAAATGTACCTCAGTCTAATCAGACTTTTTATGACCTTTAT

AACTACATTTAAAACCCTTAAATTCTATTTCTGGGTGTTTGCGAGCCTGATTGCTATCATGAAGTAAAAATTTATTACTCTAGGTATTCACTAGATAAAT

ATAGTTCTTGTTTAGTAAGCATATACTGTTTCTCAACTCTTCTCCAGCTTTTGCAGTGTACTGGCATCCTTAAAATACTTTGAAAATATGGCCTTGATCC

ATGAATTAAATCAGTATCTAAGTGAATGTGTTGATGTTTTATTGATGAGATCTATATACATGGGAATACAGTATATATCTGGGTATTCTTATAGATAATC

TTTTTAACATCCTATTTTTTTCATTAATTACATATCAACATTAATTTTGTATCTTGAAACAAATTGATTTTGTATAATTGAATGTGTTGTGCATCTGTAT

TTGATTTGATGGTATAAGGTTATGAAAATAATGTCCTGCCCCTTATATTACTGTTTTGAAAGGAGAAAGCTATGTAGAATGATATGTTAAGGGTGAAAAT

AGCAATACAGTAGATTTGAATGTCTTTTTGATCTGCATTAGTTCATTTATGTTTACATCGTAGTTAGAGATCTTTTCATTTGCTCTTGTCTTTGCTCACT

TCAATTTGAAAGCCTCATGACACATATTTCTTTGAAACTTTGATTTATATAATTTTTATAAAATATTTTAGGATGTACAAATATTGTATTTTTTTATTAA

AATACAGTATTTGTAAATGACCATAGCTACTTCACAGTTACTTGTTAGTCCCAGTGTAGTTATATCAGTGTTTACTGAAGGGAACACAAAAATATTAATG

GTATATTACAGAATGAAAACTTTCTTAAAGGAAAATTGCACCTATTTTACATTTTTGAGACTAAGCCATGAAATCTTGTAATATGTCTCTTAACTATTTA

TAATGAAAGTTGGCATTTGGGTATAGTCAGCACAGCAATGTTCTGTATCCTTAGGATTGTATAAGTAGGACATTTTAAAGATGACTCATGTCATTCTGGA

GCTCCTACTAGAGAAAACTGTAAAAAGGGTGACCTTGTAGGAAGGAGCTGAGGCCTCCCTCTGAGGGTCTCTTTTTCTTGGTGCTTTATTAGCAACTCTG

GATATTTTTATAAAACTAGATACATTAGAAACTAATTCAGTCTTGTTTAATTTACATTAGGTTTTATGTAAGAAATGTCATCAAAATACCCAATGAGCAG

GCTGATTGCAGTAGACTCAGACAGGGCCAGTGAATCTCAGCTGAGAGTCTATTCGTGGTGAAGAGAACATCCCAGTGCCTTTAACCTGAATTTCTAATCT

TATGTGAAATGGGTGCAGCATTCCTTTGGACAAAAGCTTCCACTTGGTAATTTTTGTGTTTTTCTCACTTTAAGTATTCCCCAAAGCACCAACTTCTCTT

CCTTCTTGGTCAGTCAGTATATTGTAAGATTATTTTCCATTAAATGACATCATTACCGGTTGTCTCTAAAGTACAACCAACAGAATGTTTCTTAACTGCG

GGGACCAAAAGGGAGAGACTCTGAGCTCTACAAGAGTATATATATAATAAAATGTTTGAATAATATTAAATTAAGACATTATTGGTCCTGTGATTTCTTG

CTCAGTGTTTTTCCAATTTGTCATTTGAATGATTCTTACTAAAGTTATTTTATGTGGGTATTTTATTTTTAATGGTATTATAGTTTGTATATTTAACAGT

AAGGGGGAAAGTAACCAAAATTAGTATTCTTTCACTATACATATTGGTACTTGAAACTTCCTTTAAAAAAAATCAACAAAAAACTCAAACTTTTAGTGCT

TAATTCCTCATTTTAACCTGTGATCTTTCTAATTGAAAAGCTGTGTTATTTTTGACTACCATGCATGTGGGGTTAAGCTGATGTTGAAACAGTTTGCAGT

TAAAAAAAAATCTTAATCAGCTTAAGTCATTCAATCATTTCAAGTGAGTTCTGCATCCTTTAAAAGTAAGTTTGTGAGATTTTAAGAGAATTGTGTTTTC

ATTAAATTTTGTGTATTTTTTGTTATGCCATGTAAATTCCCTTTTTCCTATGATTAAAGGAAGGGTATGATG
Translation
MFYLDLTLLHRATEETGEESF FSVQNGSIHQKDAVNDDDFEPYLSSQTNQ - UNI7177 - NNSYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGD

QPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQNSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKV

PGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNNVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDE

KGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQSQQPQLQNRWVAPRNRGTGFNQNNGTGSENFGLGVVP

VSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKS

VVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRR - 

UNI16320 - ERNRNKQ
Transcript ENSMUST00000076559
Sequence
GGCGCCTGTCCGCCATTGTGGGCCCGAGGATCGGAGGACGAGCGGGGACGAGCAGTGTGCAGGCGGCGAGCTCGGGCCCCTTCCGCGACTCCCGAGCGTG

AGCCCTCTCCCTGGAGCCTGCGAGAGCGGCGGCGGCGGAGGCCGGAGCAGAGCTTCGCGAGGGCGGTAGTCGACTGCTGTGAGTGCTCTCGGCGAGGCCC

AGGCAGCGGCGGCGGCGGCGGCGGTTCCTCTCGGGTTACGGTGAAGAATGTCAGCCACTAGCGTGGATCAG - UNI1237 - AGACCTAAAGGGCAAG

GAAATAAAG - UNI29617 - TTTCAGTACAAAATGGTTCGATTCATCAAAAAGATGCTGTAAATGATGATGATTTTGAGCCATACTTAAGTAGCCAG

ACAAATCAG - UNI7177 - AAATATAGGAGAGCAAAACAGTTGTTTCATTGT AATAACAGCTATCCACCAATGTCAGATCCATATATGCCTAGTTA

CTATGCTCCGTCCATTGGATTTCCATATTCTCTTGGGGAAGCAGCATGGTCCACGGCTGGAGATCAGCCTATGCCATATCTGACAACCTATGGACAAATG

AGTAATGGAGAACATCATTATATACCAGATGGTGTTTTTAGTCAACCAGGGGCATTAGGAAATACCCCTCCATTTCTTGGTCAACATGGATTTAACTTTT

TTCCTGGTAATGCTGATTTCTCTACATGGGGAACAAGTGGATCTCAGGGACAATCAACACAAAATTCTGCTTATAGTAGCAGTTACGGCTATCCACCTAG

TTCTCTTGGGAGAGCTATTACTGATGGACAGGCCGGATTTGGCAATGATACTTTGAGTAAGGTGCCTGGCATTAGTAGTATTGAGCAAGGCATGACTGGA

CTGAAAATTGGTGGTGACCTGACAGCTGCGGTGACGAAAACTGTAGGTACAGCCTTGAGCAGCAGTGGTATGACTAGCATTGCAACCAATAATGTGCCCC

CTGTTAGCAGTGCAGCACCTAAACCAACTTCTTGGGCTGCTATTGCCAGAAAGCCTGCAAAACCTCAGCCGAAACTTAAACCCAAGGGCAATGTGGGAAT

TGGGGGTTCTGCTGTGCCACCACCTCCTATAAAACACAACATGAATATTGGAACTTGGGATGAAAAGGGGTCAGTGGTAAAGGCTCCACCAACCCAACCA

GTTCTGCCTCCTCAAACTATAATCCAGCAGCCTCAGCCATTAATTCAACCACCACCATTGGTGCAAAGCCAACTGCCTCAACAGCAGCCTCAGCCACCAC

AACCACAGCAGCAACAAGGACCTCAGCCACAGGCCCAGCCTCACCAAGTGCAGTCTCAACAGCCACAGTTGCAGAATCGTTGGGTAGCTCCTCGGAATAG

GGGAACCGGCTTCAACCAGAACAATGGAACAGGCAGTGAAAACTTTGGTTTAGGTGTTGTGCCTGTTAGTGCTTCACCTTCTAGTGTAGAGGTGCATCCA

GTGCTGGAAAAACTAAAGGCCATAAACAATTATAATCCCAAAGACTTTGATTGGAACCTGAAGAATGGACGTGTGTTTATAATTAAGAGCTATTCTGAGG

ATGATATACATCGTTCCATCAAGTACTCTATCTGGTGTAGTACTGAGCATGGTAATAAGCGTTTGGATGCAGCTTATCGTTCCCTGAATGGGAAAGGCCC

ACTCTATTTACTCTTCAGTGTGAATGGCAGTGGACATTTTTGTGGAGTGGCTGAAATGAAGTCTGTTGTAGACTATAATGCTTATGCTGGTGTCTGGTCT

CAGGATAAGTGGAAGGGCAAATTTGAAGTTAAATGGATCTTTGTCAAAGATGTTCCCAATAACCAATTACGACATATTCGCTTAGAAAATAATGACAACA

AACCAGTAACCAATTCAAGGGACACTCAAGAAGTACCCCTAGAAAAAGCAAAGCAAGTGCTTAAAATAATCGCTACTTTCAAGCATACCACCTCAATCTT

TGATGACTTTGCACATTATGAAAAGCGTCAAGAGGAGGAGGAAGCCATGCGAAGGGTAAGAA AAAGGAATCAACAG
Translation
MSATSVDQ - UNI1237 - RPKGQGNKV - UNI29617 - VSVQNGSIHQKDAVNDDDFEPYLSSQTNQ - UNI7177 - KYRRAKQLFHC NN

SYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQ

NSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNNVPPVSSAAPKPTSWAAIARKPAK

PQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQSQQ

PQLQNRWVAPRNRGTGFNQNNGTGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR

LDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVL

KIIATFKHTTSIFDDFAHYEKRQEEEEAMRRVRK KRNQQ
Transcript ENSMUST00000108345
Sequence
GGCGCCTGTCCGCCATTGTGGGCCCGAGGATCGGAGGACGAGCGGGGACGAGCAGTGTGCAGGCGGCGAGCTCGGGCCCCTTCCGCGACTCCCGAGCGTG

AGCCCTCTCCCTGGAGCCTGCGAGAGCGGCGGCGGCGGAGGCCGGAGCAGAGCTTCGCGAGGGCGGTAGTCGACTGCTGTGAGTGCTCTCGGCGAGGCCC

AGGCAGCGGCGGCGGCGGCGGCGGTTCCTCTCGGGTTACGGTGAAGAATGTCAGCCACTAGCGTGGATCAG - UNI1237 - AGACCTAAAGGGCAAG

GAAATAAAG - UNI29617 - TTTCAGTACAAAATGGTTCGATTCATCAAAAAGATGCTGTAAATGATGATGATTTTGAGCCATACTTAAGTAGCCAG

ACAAATCAG - UNI7177 - AATAACAGCTATCCACCAATGTCAGATCCATATATGCCTAGTTACTATGCTCCGTCCATTGGATTTCCATATTCTCTT

GGGGAAGCAGCATGGTCCACGGCTGGAGATCAGCCTATGCCATATCTGACAACCTATGGACAAATGAGTAATGGAGAACATCATTATATACCAGATGGTG

TTTTTAGTCAACCAGGGGCATTAGGAAATACCCCTCCATTTCTTGGTCAACATGGATTTAACTTTTTTCCTGGTAATGCTGATTTCTCTACATGGGGAAC

AAGTGGATCTCAGGGACAATCAACACAAAATTCTGCTTATAGTAGCAGTTACGGCTATCCACCTAGTTCTCTTGGGAGAGCTATTACTGATGGACAGGCC

GGATTTGGCAATGATACTTTGAGTAAGGTGCCTGGCATTAGTAGTATTGAGCAAGGCATGACTGGACTGAAAATTGGTGGTGACCTGACAGCTGCGGTGA

CGAAAACTGTAGGTACAGCCTTGAGCAGCAGTGGTATGACTAGCATTGCAACCAATAATGTGCCCCCTGTTAGCAGTGCAGCACCTAAACCAACTTCTTG

GGCTGCTATTGCCAGAAAGCCTGCAAAACCTCAGCCGAAACTTAAACCCAAGGGCAATGTGGGAATTGGGGGTTCTGCTGTGCCACCACCTCCTATAAAA

CACAACATGAATATTGGAACTTGGGATGAAAAGGGGTCAGTGGTAAAGGCTCCACCAACCCAACCAGTTCTGCCTCCTCAAACTATAATCCAGCAGCCTC

AGCCATTAATTCAACCACCACCATTGGTGCAAAGCCAACTGCCTCAACAGCAGCCTCAGCCACCACAACCACAGCAGCAACAAGGACCTCAGCCACAGGC

CCAGCCTCACCAAGTGCAGTCTCAACAGCCACAGTTGCAGAATCGTTGGGTAGCTCCTCGGAATAGGGGAACCGGCTTCAACCAGAACAATGGAACAGGC

AGTGAAAACTTTGGTTTAGGTGTTGTGCCTGTTAGTGCTTCACCTTCTAGTGTAGAGGTGCATCCAGTGCTGGAAAAACTAAAGGCCATAAACAATTATA

ATCCCAAAGACTTTGATTGGAACCTGAAGAATGGACGTGTGTTTATAATTAAGAGCTATTCTGAGGATGATATACATCGTTCCATCAAGTACTCTATCTG

GTGTAGTACTGAGCATGGTAATAAGCGTTTGGATGCAGCTTATCGTTCCCTGAATGGGAAAGGCCCACTCTATTTACTCTTCAGTGTGAATGGCAGTGGA

CATTTTTGTGGAGTGGCTGAAATGAAGTCTGTTGTAGACTATAATGCTTATGCTGGTGTCTGGTCTCAGGATAAGTGGAAGGGCAAATTTGAAGTTAAAT

GGATCTTTGTCAAAGATGTTCCCAATAACCAATTACGACATATTCGCTTAGAAAATAATGACAACAAACCAGTAACCAATTCAAGGGACACTCAAGAAGT

ACCCCTAGAAAAAGCAAAGCAAGTGCTTAAAATAATCGCTACTTTCAAGCATACCACCTCAATCTTTGATGACTTTGCACATTATGAAAAGCGTCAAGAG

GAGGAGGAAGCCATGCGAAGG - UNI16320 - GAGAGAAATAGAAACAAGCAATAACCACCGTGTGGAGATGTCCTATTAAAATGACAACACTAATG

ATGTAGACTCTGGAAATGCCTAATAAGTCAAAGAAGATGTTATTAAAGCTTTTTGTTTTCTGCTTAAGGTGACATCTTTGAACCCTTTAACATGAAATTG

ATTCTTCTTGTAATGGTTTTCATCAGCGCATCTGCCCTTATTCTCTCACCAAACACACTTGAGAACTGTAACTTCATGAAGCACTTTGTGTCCTGAAGCT

TTTACCAGTACCTGCTGTCTTTTGTAATTATGCATCCTAGCTAAGGCACAGAAGACTGAATGAATTGCAAGGATTCATTAACTCTTGGAATTTGTTAAGT

ACTAACAGTTATCCATTAGAAGTGGTTCAATGATGTAAGAGTCTCACTGCTTCAATCTTTTCATTGTCGTAGTTTTTAAATTGTCAATTTTTAGCTATTT

GACAGATTAAAAGCAAAATAATCATGCCATATTTAGTCTGGAGTTCAAGTCTGAATGTTTATGTGAAAAATTATTGTAGCAAACTTTTAATATGGCAAAG

CAACCTTATGCTCTATTTTAGCCAAACAGTACATAATCTAAAATTATATATTAGAACATTTCCCTTGTCTTCAAACTATTTGATGTAACAAATATGCAGC

CTGGTGGGCTTCACCAATTAATGCACATCCCCTCCTCTCCAGTTACATGTACACTGAGAATATGCGTTGGTTTGAGGGATTATTTTGTTTCTACCACTTA

ATGAATCTCAACATTTTGAGTAAATGTACCTCAGTCTAATCAGACTTTTTATGACCTTTATAACTACATTTAAAACCCTTAAATTCTATTTCTGGGTGTT

TGCGAGCCTGATTGCTATCATGAAGTAAAAATTTATTACTCTAGGTATTCACTAGATAAATATAGTTCTTGTTTAGTAAGCATATACTGTTTCTCAACTC

TTCTCCAGCTTTTGCAGTGTACTGGCATCCTTAAAATACTTTGAAAATATGGCCTTGATCCATGAATTAAATCAGTATCTAAGTGAATGTGTTGATGTTT

TATTGATGAGATCTATATACATGGGAATACAGTATATATCTGGGTATTCTTATAGATAATCTTTTTAACATCCTATTTTTTTCATTAATTACATATCAAC

ATTAATTTTGTATCTTGAAACAAATTGATTTTGTATAATTGAATGTGTTGTGCATCTGTATTTGATTTGATGGTATAAGGTTATGAAAATAATGTCCTGC

CCCTTATATTACTGTTTTGAAAGGAGAAAGCTATGTAGAATGATATGTTAAGGGTGAAAATAGCAATACAGTAGATTTGAATGTCTTTTTGATCTGCATT

AGTTCATTTATGTTTACATCGTAGTTAGAGATCTTTTCATTTGCTCTTGTCTTTGCTCACTTCAATTTGAAAGCCTCATGACACATATTTCTTTGAAACT

TTGATTTATATAATTTTTATAAAATATTTTAGGATGTACAAATATTGTATTTTTTTATTAAAATACAGTATTTGTAAATGACCATAGCTACTTCACAGTT

ACTTGTTAGTCCCAGTGTAGTTATATCAGTGTTTACTGAAGGGAACACAAAAATATTAATGGTATATTACAGAATGAAAACTTTCTTAAAGGAAAATTGC

ACCTATTTTACATTTTTGAGACTAAGCCATGAAATCTTGTAATATGTCTCTTAACTATTTATAATGAAAGTTGGCATTTGGGTATAGTCAGCACAGCAAT

GTTCTGTATCCTTAGGATTGTATAAGTAGGACATTTTAAAGATGACTCATGTCATTCTGGAGCTCCTACTAGAGAAAACTGTAAAAAGGGTGACCTTGTA

GGAAGGAGCTGAGGCCTCCCTCTGAGGGTCTCTTTTTCTTGGTGCTTTATTAGCAACTCTGGATATTTTTATAAAACTAGATACATTAGAAACTAATTCA

GTCTTGTTTAATTTACATTAGGTTTTATGTAAGAAATGTCATCAAAATACCCAATGAGCAGGCTGATTGCAGTAGACTCAGACAGGGCCAGTGAATCTCA

GCTGAGAGTCTATTCGTGGTGAAGAGAACATCCCAGTGCCTTTAACCTGAATTTCTAATCTTATGTGAAATGGGTGCAGCATTCCTTTGGACAAAAGCTT

CCACTTGGTAATTTTTGTGTTTTTCTCACTTTAAGTATTCCCCAAAGCACCAACTTCTCTTCCTTCTTGGTCAGTCAGTATATTGTAAGATTATTTTCCA

TTAAATGACATCATTACCGGTTGTCTCTAAAGTACAACCAACAGAATGTTTCTTAACTGCGGGGACCAAAAGGGAGAGACTCTGAGCTCTACAAGAGTAT

ATATATAATAAAATGTTTGAATAATATTAAATTAAGACATTATTGGTCCTGTGATTTCTTGCTCAGTGTTTTTCCAATTTGTCATTTGAATGATTCTTAC

TAAAGTTATTTTATGTGGGTATTTTATTTTTAATGGTATTATAGTTTGTATATTTAACAGTAAGGGGGAAAGTAACCAAAATTAGTATTCTTTCACTATA

CATATTGGTACTTGAAACTTCCTTTAAAAAAAATCAACAAAAAACTCAAACTTTTAGTGCTTAATTCCTCATTTTAACCTGTGATCTTTCTAATTGAAAA

GCTGTGTTATTTTTGACTACCATGCATGTGGGGTTAAGCTGATGTTGAAACAGTTTGCAGTTAAAAAAAAATCTTAATCAGCTTAAGTCATTCAATCATT

TCAAGTGAGTTCTGCATCCTTTAAAAGTAAGTTTGTGAGATTTTAAGAGAATTGTGTTTTCATTAAATTTTGTGTATTTTTTGTTATGCCATGTAAATTC

CCTTTTTCCTATGATTAAAGGAAGGGTATGATG
Translation
MSATSVDQ - UNI1237 - RPKGQGNKV - UNI29617 - VSVQNGSIHQKDAVNDDDFEPYLSSQTNQ - UNI7177 - NNSYPPMSDPYMPS

YYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQNSAYSSSYGYPP

SSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNNVPPVSSAAPKPTSWAAIARKPAKPQPKLKPKGNVG

IGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQSQQPQLQNRWVAPRN

RGTGFNQNNGTGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKG

PLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSI

FDDFAHYEKRQEEEEAMRR - UNI16320 - ERNRNKQ
Transcript ENSMUST00000108346
Sequence
GGCGCCTGTCCGCCATTGTGGGCCCGAGGATCGGAGGACGAGCGGGGACGAGCAGTGTGCAGGCGGCGAGCTCGGGCCCCTTCCGCGACTCCCGAGCGTG

AGCCCTCTCCCTGGAGCCTGCGAGAGCGGCGGCGGCGGAGGCCGGAGCAGAGCTTCGCGAGGGCGGTAGTCGACTGCTGTGAGTGCTCTCGGCGAGGCCC

AGGCAGCGGCGGCGGCGGCGGCGGTTCCTCTCGGGTTACGGTGAAGAATGTCAGCCACTAGCGTGGATCAG - UNI1237 - AGACCTAAAGGGCAAG

GAAATAAAG - UNI29617 - TTTCAGTACAAAATGGTTCGATTCATCAAAAAGATGCTGTAAATGATGATGATTTTGAGCCATACTTAAGTAGCCAG

ACAAATCAG - UNI7177 - AAATATAGGAGAGCAAAACAGTTGTTTCATTGT AATAACAGCTATCCACCAATGTCAGATCCATATATGCCTAGTTA

CTATGCTCCGTCCATTGGATTTCCATATTCTCTTGGGGAAGCAGCATGGTCCACGGCTGGAGATCAGCCTATGCCATATCTGACAACCTATGGACAAATG

AGTAATGGAGAACATCATTATATACCAGATGGTGTTTTTAGTCAACCAGGGGCATTAGGAAATACCCCTCCATTTCTTGGTCAACATGGATTTAACTTTT

TTCCTGGTAATGCTGATTTCTCTACATGGGGAACAAGTGGATCTCAGGGACAATCAACACAAAATTCTGCTTATAGTAGCAGTTACGGCTATCCACCTAG

TTCTCTTGGGAGAGCTATTACTGATGGACAGGCCGGATTTGGCAATGATACTTTGAGTAAGGTGCCTGGCATTAGTAGTATTGAGCAAGGCATGACTGGA

CTGAAAATTGGTGGTGACCTGACAGCTGCGGTGACGAAAACTGTAGGTACAGCCTTGAGCAGCAGTGGTATGACTAGCATTGCAACCAATAATGTGCCCC

CTGTTAGCAGTGCAGCACCTAAACCAACTTCTTGGGCTGCTATTGCCAGAAAGCCTGCAAAACCTCAGCCGAAACTTAAACCCAAGGGCAATGTGGGAAT

TGGGGGTTCTGCTGTGCCACCACCTCCTATAAAACACAACATGAATATTGGAACTTGGGATGAAAAGGGGTCAGTGGTAAAGGCTCCACCAACCCAACCA

GTTCTGCCTCCTCAAACTATAATCCAGCAGCCTCAGCCATTAATTCAACCACCACCATTGGTGCAAAGCCAACTGCCTCAACAGCAGCCTCAGCCACCAC

AACCACAGCAGCAACAAGGACCTCAGCCACAGGCCCAGCCTCACCAAGTGCAGTCTCAACAGCCACAGTTGCAGAATCGTTGGGTAGCTCCTCGGAATAG

GGGAACCGGCTTCAACCAGAACAATGGAACAGGCAGTGAAAACTTTGGTTTAGGTGTTGTGCCTGTTAGTGCTTCACCTTCTAGTGTAGAGGTGCATCCA

GTGCTGGAAAAACTAAAGGCCATAAACAATTATAATCCCAAAGACTTTGATTGGAACCTGAAGAATGGACGTGTGTTTATAATTAAGAGCTATTCTGAGG

ATGATATACATCGTTCCATCAAGTACTCTATCTGGTGTAGTACTGAGCATGGTAATAAGCGTTTGGATGCAGCTTATCGTTCCCTGAATGGGAAAGGCCC

ACTCTATTTACTCTTCAGTGTGAATGGCAGTGGACATTTTTGTGGAGTGGCTGAAATGAAGTCTGTTGTAGACTATAATGCTTATGCTGGTGTCTGGTCT

CAGGATAAGTGGAAGGGCAAATTTGAAGTTAAATGGATCTTTGTCAAAGATGTTCCCAATAACCAATTACGACATATTCGCTTAGAAAATAATGACAACA

AACCAGTAACCAATTCAAGGGACACTCAAGAAGTACCCCTAGAAAAAGCAAAGCAAGTGCTTAAAATAATCGCTACTTTCAAGCATACCACCTCAATCTT

TGATGACTTTGCACATTATGAAAAGCGTCAAGAGGAGGAGGAAGCCATGCGAAGG - UNI16320 - GAGAGAAATAGAAACAAGCAATAACCACCGT

GTGGAGATGTCCTATTAAAATGACAACACTAATGATGTAGACTCTGGAAATGCCTAATAAGTCAAAGAAGATGTTATTAAAGCTTTTTGTTTTCTGCTTA

AGGTGACATCTTTGAACCCTTTAACATGAAATTGATTCTTCTTGTAATGGTTTTCATCAGCGCATCTGCCCTTATTCTCTCACCAAACACACTTGAGAAC

TGTAACTTCATGAAGCACTTTGTGTCCTGAAGCTTTTACCAGTACCTGCTGTCTTTTGTAATTATGCATCCTAGCTAAGGCACAGAAGACTGAATGAATT

GCAAGGATTCATTAACTCTTGGAATTTGTTAAGTACTAACAGTTATCCATTAGAAGTGGTTCAATGATGTAAGAGTCTCACTGCTTCAATCTTTTCATTG

TCGTAGTTTTTAAATTGTCAATTTTTAGCTATTTGACAGATTAAAAGCAAAATAATCATGCCATATTTAGTCTGGAGTTCAAGTCTGAATGTTTATGTGA

AAAATTATTGTAGCAAACTTTTAATATGGCAAAGCAACCTTATGCTCTATTTTAGCCAAACAGTACATAATCTAAAATTATATATTAGAACATTTCCCTT

GTCTTCAAACTATTTGATGTAACAAATATGCAGCCTGGTGGGCTTCACCAATTAATGCACATCCCCTCCTCTCCAGTTACATGTACACTGAGAATATGCG

TTGGTTTGAGGGATTATTTTGTTTCTACCACTTAATGAATCTCAACATTTTGAGTAAATGTACCTCAGTCTAATCAGACTTTTTATGACCTTTATAACTA

CATTTAAAACCCTTAAATTCTATTTCTGGGTGTTTGCGAGCCTGATTGCTATCATGAAGTAAAAATTTATTACTCTAGGTATTCACTAGATAAATATAGT

TCTTGTTTAGTAAGCATATACTGTTTCTCAACTCTTCTCCAGCTTTTGCAGTGTACTGGCATCCTTAAAATACTTTGAAAATATGGCCTTGATCCATGAA

TTAAATCAGTATCTAAGTGAATGTGTTGATGTTTTATTGATGAGATCTATATACATGGGAATACAGTATATATCTGGGTATTCTTATAGATAATCTTTTT

AACATCCTATTTTTTTCATTAATTACATATCAACATTAATTTTGTATCTTGAAACAAATTGATTTTGTATAATTGAATGTGTTGTGCATCTGTATTTGAT

TTGATGGTATAAGGTTATGAAAATAATGTCCTGCCCCTTATATTACTGTTTTGAAAGGAGAAAGCTATGTAGAATGATATGTTAAGGGTGAAAATAGCAA

TACAGTAGATTTGAATGTCTTTTTGATCTGCATTAGTTCATTTATGTTTACATCGTAGTTAGAGATCTTTTCATTTGCTCTTGTCTTTGCTCACTTCAAT

TTGAAAGCCTCATGACACATATTTCTTTGAAACTTTGATTTATATAATTTTTATAAAATATTTTAGGATGTACAAATATTGTATTTTTTTATTAAAATAC

AGTATTTGTAAATGACCATAGCTACTTCACAGTTACTTGTTAGTCCCAGTGTAGTTATATCAGTGTTTACTGAAGGGAACACAAAAATATTAATGGTATA

TTACAGAATGAAAACTTTCTTAAAGGAAAATTGCACCTATTTTACATTTTTGAGACTAAGCCATGAAATCTTGTAATATGTCTCTTAACTATTTATAATG

AAAGTTGGCATTTGGGTATAGTCAGCACAGCAATGTTCTGTATCCTTAGGATTGTATAAGTAGGACATTTTAAAGATGACTCATGTCATTCTGGAGCTCC

TACTAGAGAAAACTGTAAAAAGGGTGACCTTGTAGGAAGGAGCTGAGGCCTCCCTCTGAGGGTCTCTTTTTCTTGGTGCTTTATTAGCAACTCTGGATAT

TTTTATAAAACTAGATACATTAGAAACTAATTCAGTCTTGTTTAATTTACATTAGGTTTTATGTAAGAAATGTCATCAAAATACCCAATGAGCAGGCTGA

TTGCAGTAGACTCAGACAGGGCCAGTGAATCTCAGCTGAGAGTCTATTCGTGGTGAAGAGAACATCCCAGTGCCTTTAACCTGAATTTCTAATCTTATGT

GAAATGGGTGCAGCATTCCTTTGGACAAAAGCTTCCACTTGGTAATTTTTGTGTTTTTCTCACTTTAAGTATTCCCCAAAGCACCAACTTCTCTTCCTTC

TTGGTCAGTCAGTATATTGTAAGATTATTTTCCATTAAATGACATCATTACCGGTTGTCTCTAAAGTACAACCAACAGAATGTTTCTTAACTGCGGGGAC

CAAAAGGGAGAGACTCTGAGCTCTACAAGAGTATATATATAATAAAATGTTTGAATAATATTAAATTAAGACATTATTGGTCCTGTGATTTCTTGCTCAG

TGTTTTTCCAATTTGTCATTTGAATGATTCTTACTAAAGTTATTTTATGTGGGTATTTTATTTTTAATGGTATTATAGTTTGTATATTTAACAGTAAGGG

GGAAAGTAACCAAAATTAGTATTCTTTCACTATACATATTGGTACTTGAAACTTCCTTTAAAAAAAATCAACAAAAAACTCAAACTTTTAGTGCTTAATT

CCTCATTTTAACCTGTGATCTTTCTAATTGAAAAGCTGTGTTATTTTTGACTACCATGCATGTGGGGTTAAGCTGATGTTGAAACAGTTTGCAGTTAAAA

AAAAATCTTAATCAGCTTAAGTCATTCAATCATTTCAAGTGAGTTCTGCATCCTTTAAAAGTAAGTTTGTGAGATTTTAAGAGAATTGTGTTTTCATTAA

ATTTTGTGTATTTTTTGTTATGCCATGTAAATTCCCTTTTTCCTATGATTAAAGGAAGGGTATGATG
Translation
MSATSVDQ - UNI1237 - RPKGQGNKV - UNI29617 - VSVQNGSIHQKDAVNDDDFEPYLSSQTNQ - UNI7177 - KYRRAKQLFHC NN

SYPPMSDPYMPSYYAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQ

NSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSKVPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNNVPPVSSAAPKPTSWAAIARKPAK

PQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTIIQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQSQQ

PQLQNRWVAPRNRGTGFNQNNGTGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR

LDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVL

KIIATFKHTTSIFDDFAHYEKRQEEEEAMRR - UNI16320 - ERNRNKQ

For any suggestions or comments, please send an email to unitrap@crg.es