Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047242 (Taf9b)
Chromosomal location
Chr X: 103402222 - 103416478 (-)
Description
TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor Gene [Source:MGI (curated);Acc:Taf9b-002]
RefSeq_dna
NM_001001176 
RefSeq_peptide
NP_001001176.1 
UniGene
Mm.19440 Mm.407841 Mm.410328 
MGI
MGI:3039562 
Uniprot/SWISSPROT
Q6NZA9 
Uniprot/SPTREMBL
A2AP80 A2AP81 A2AP82 
Human Ortholog
ENSG00000215760 (BX276116.7-203)
Omim not available
UniTrap UNI8815
Vector Insertion
Chr X: 103403997 - 103405045
Public Clones TEA124 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055497
Sequence
AGGGCGACTTCCTCCGCACCTCTCCACCTCCGAACCTGCATGGGCCCCGGGTAGCCAAGTCCACACAGGTGGGGGCTGGCGGCTGGGAAGCAGCCCCGGC

CGGGGAGCTGCGTGCTAGGACCGCCTTCCATCCCCCACAGGGGTGGAGCCAGACCGAGGTGGAAACCGCCTGCAGCTCTATCTCCGAGGTTGAGGAGCCG

CAAGAGAAAATGGAGCCGGCCAAGATGGCGCCTATCAAGAACGCTCCGAGAGATGCCTTG GTGATGGCACAGATCCTGAAGGATATGGGAATCACAGAG

TATGAGCCAAGGGTTATAAATCAAATGTTGGAATTTGCTTTCC GATATGTGACTACAATTCTGGACGATGCAAAGATTTATTCGAGTCATGCTAAGAAA

CCCACTGTTGATGCCGATGACGTGAGACTGGCCATCCAGTGTCGGGCTGACCAGTCCTTTACCTCTCCTCCCCCAAGAGAT TTTTTACTAGATATTGCA

AGGCAGAAGAATCAAACCCCTTTGCCGCTGATTAAGCCATATGCAGGACCCAGACTGCCACCTGATAGATACTGCTTAACAGCTCCAAACTATAGGCTGA

AGTCCTTAGTTAAAAAG GGACCTAACCAAGGAAGACTAGTGCCTAGATTAAGTGCGGTCAGTAGTAGACCAACTACTCCTCCTGTAG CACCCCCACAA

GCAGTATCTGGCCCAAATAAGGCTGCAACTCCGGTGTCAGTGACAAGCCAAAGATTTGCTGTGCAGATTCCACCTTCTCAGTCCACACCTGCCAAGCCAG

 - UNI8815 - CTCCTGCAGCAACTGCAGTCCAAAATGTTCTGATTAATCCTTCAATGATTGGGCCCAAAAATATTCTCATTACCACCAGCATGGTTT

CCTCACAGAACACAGCCACCGACTCAAACCCACTGAAGAGGAAGCATGATGACGACGATGACAATGACACCATGTAAGGAATAAAGTCTGTTCTGCATAC

ATTAACATTTTTGTGTGTTTGGGCCCATATGGCGGACTCAATAGCCTAAGTCTTCATAAGTTTTATCTTAGAAACGTAGTAGTAATATTTTTCACATTAG

TTACATCTGGAAGGTTTTGTTACAGTACAAGTACTTGCTTCTAGACAGCTTCATTAATGTTGAGTCTCACCATGGCAACTCTGTTTTTAGAAGCAGTTTT

CCGATATGTGTCACTAGCAGCAGCGCTTGGACTTCAGCTCCTGGTCTCATTTACATTTAACAGGACTTTCTTTTGATAGTGAACTATTCACATTGTCACT

TTTTGACCAAATCTCTCAATTTAGGAACCAAATCTCTCAATTTAGGAAACTTTTTTTTTTTTGAAGAGTGGATTTAGAAGTGTGCTAAATCCATTTTGAA

TGTATTTGGGTTTTGGTCTTTTCTGATTTCCTATCTAGATCTCGTTTGTTTTCTGTTCCCACCTCTCATCGCCTTAAGTCATTTGCCATTGCACTTAAAT

GTAATAGACTGTGACTGGAATGTGTAATATGCCCTAGATGCCTGGCACTCTGCAGTTCCTGTGAACCGGAGTGTCTGCTTTTGCTCTTCTTCACTCCTAA

CAGAGCATTCGGGTCTCAGCACTTGCCTTTCATGCCTGCTAAGCACTTCTCATTGATAGGCACTTTTGCATCAATTGCATTCACAATCTTTCATGTTTAA

AATTTAAAATATAACTTAAAACCTGCCTTGGAAAGTAATTTACACTGGACTCAGACAAAACCACTAAAGAACTTTGTTGTTTTTCTTAACCACCTGCATA

TATATATGCTTTGGTCACTACGGCTTGAACCAGTCCGTTGGTTTCATTCAGACCACCTTTCTAGCTTGCTGCTGAGGGTGTCACACATAAGATGGGATCA

AGCCTGAAGGAAGATTCTGATTCTCTTTCCCTATCAGGCCAACAGGGAAAAGTCACCTGACTCCATTTAGGTACCCCAAAATTTCCCAACCATGTTTCTA

TACACCTTCTTCTACTCTGTTAATACATACGTACAAGACTCACTGGGAACAACAGCAAAGCTTTTTTCCAAGTATAAAAAGAACTGATTTGATTTGGTTT

AAGTTCCACATAGCCAACATTGGAAAAACTTTCTGAAACCTTCATGCCACTTAAAATTTATAGCCATGGATCATCAAAACTTACTAAGTATCAGCATAGG

GTGGTGTTTGACACATGAAATAGATCAGTAACAAGACAGAGATATTTCATGCCAGTTTTAATTGTCTAGGACGGTTAGTGAAAGCTGATCTGATCAATAC

CATAAGAGAAATGTGCAGTATACAACACAGATGTCAGGACTAGAATGTTCTCAGGGAGGCAGAATACAAGAAAGCCTAGGTTCTGGTATTAGTTTCATTT

ACCAACAATGTGACCTTACTTTACCTCGGAGCCTTGTTCTCACTAGTAATAGGGAAATAACATCTACCCTGCCTACCTCACAGGGATGTTGTGAGGGTTT

AGCTGGTGTGTGTGAAAGTTCCAAGATTGTAAAAGCTATATAATTATTAATATATTTGTTTCAACATTGTTAATAAAAATTTAACTTT
Translation
MEPAKMAPIKNAPRDAL VMAQILKDMGITEYEPRVINQMLEFAFR RYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRD FLLDIA

RQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLVKK GPNQGRLVPRLSAVSSRPTTPPVA APPQAVSGPNKAATPVSVTSQRFAVQIPPSQSTPA

KPA - UNI8815 - APAATAVQNVLINPSMIGPKNILITTSMVSSQNTATDSNPLKRKHDDDDDNDTM
Transcript ENSMUST00000113495
Sequence
ATGGCTGACCAGGAGTCGGATGCGTTTGACCAGATTGTCGAGGAGGAGTCGTCCTCGGATGAG GGGTGGAGCCAGACCGAGGTGGAAACCGCCTGCAGC

TCTATCTCCGAGGTTGAGGAGCCGCAAGAGAAAATGGAGCCGGCCAAGATGGCGCCTATCAAGAACGCTCCGAGAGATGCCTTG GTGATGGCACAGATC

CTGAAGGATATGGGAATCACAGAGTATGAGCCAAGGGTTATAAATCAAATGTTGGAATTTGCTTTCC GATATGTGACTACAATTCTGGACGATGCAAAG

ATTTATTCGAGTCATGCTAAGAAACCCACTGTTGATGCCGATGACGTGAGACTGGCCATCCAGTGTCGGGCTGACCAGTCCTTTACCTCTCCTCCCCCAA

GAGAT TTTTTACTAGATATTGCAAGGCAGAAGAATCAAACCCCTTTGCCGCTGATTAAGCCATATGCAGGACCCAGACTGCCACCTGATAGATACTGCT

TAACAGCTCCAAACTATAGGCTGAAGTCCTTAGTTAAAAAG GGACCTAACCAAGGAAGACTAGTGCCTAGATTAAGTGCGGTCAGTAGTAGACCAACTA

CTCCTCCTGTAG CACCCCCACAAGCAGTATCTGGCCCAAATAAGGCTGCAACTCCGGTGTCAGTGACAAGCCAAAGATTTGCTGTGCAGATTCCACCTT

CTCAGTCCACACCTGCCAAGCCAG - UNI8815 - CTCCTGCAGCAACTGCAGTCCAAAATGTTCTGATTAATCCTTCAATGATTGGGCCCAAAAATA

TTCTCATTACCACCAGCATGGTTTCCTCACAGAACACAGCCACCGACTCAAACCCACTGAAGAGGAAGCATGATGACGACGATGACAATGACACCATGTA

AGGAATAAAGTCTGTTCTGCATACATTAACATTTTTGTGTGTTTGGGCCCATATGGCGGACTCAATAGCCTAAGTCTTCATAAGTTTTATCTTAGAAACG

TAGTAGTAATATTTTTCACATTAGTTACATCTGGAAGGTTTTGTTACAGTACAAGTACTTGCTTCTAGACAGCTTCATTAATGTTGAGTCTCACCATGGC

AACTCTGTTTTTAGAAGCAGTTTTCCGATATGTGTCACTAGCAGCAGCGCTTGGACTTCAGCTCCTGGTCTCATTTACATTTAACAGGACTTTCTTTTGA

TAGTGAACTATTCACATTGTCACTTTTTGACCAAATCTCTCAATTTAGGAACCAAATCTCTCAATTTAGGAAACTTTTTTTTTTTTGAAGAGTGGATTTA

GAAGTGTGCTAAATCCATTTTGAATGTATTTGGGTTTTGGTCTTTTCTGATTTCCTATCTAGATCTCGTTTGTTTTCTGTTCCCACCTCTCATCGCCTTA

AGTCATTTGCCATTGCACTTAAATGTAATAGACTGTGACTGGAATGTGTAATATGCCCTAGATGCCTGGCACTCTGCAGTTCCTGTGAACCGGAGTGTCT

GCTTTTGCTCTTCTTCACTCCTAACAGAGCATTCGGGTCTCAGCACTTGCCTTTCATGCCTGCTAAGCACTTCTCATTGATAGGCACTTTTGCATCAATT

GCATTCACAATCTTTCATGTTTAAAATTTAAAATATAACTTAAAACCTGCCTTGGAAAGTAATTTACACTGGACTCAGACAAAACCACTAAAGAACTTTG

TTGTTTTTCTTAACCACCTGCATATATATATGCTTTGGTCACTACGGCTTGAACCAGTCCGTTGGTTTCATTCAGACCACCTTTCTAGCTTGCTGCTGAG

GGTGTCACACATAAGATGGGATCAAGCCTGAAGGAAGATTCTGATTCTCTTTCCCTATCAGGCCAACAGGGAAAAGTCACCTGACTCCATTTAGGTACCC

CAAAATTTCCCAACCATGTTTCTATACACCTTCTTCTACTCTGTTAATACATACGTACAAGACTCACTGGGAACAACAGCAAAGCTTTTTTCCAAGTATA

AAAAGAACTGATTTGATTTGGTTTAAGTTCCACATAGCCAACATTGGAAAAACTTTCTGAAACCTTCATGCCACTTAAAATTTATAGCCATGGATCATCA

AAACTTACTAAGTATCAGCATAGGGTGGTGTTTGACACATGAAATAGATCAGTAACAAGACAGAGATATTTCATGCCAGTTTTAATTGTCTAGGACGGTT

AGTGAAAGCTGATCTGATCAATACCATAAGAGAAATGTGCAGTATACAACACAGATGTCAGGACTAGAATGTTCTCAGGGAGGCAGAATACAAGAAAGCC

TAGGTTCTGGTATTAGTTTCATTTACCAACAATGTGACCTTACTTTACCTCGGAGCCTTGTTCTCACTAGTAATAGGGAAATAACATCTACCCTGCCTAC

CTCACAGGGATGTTGTGAGGGTTTAGCTGGTGTGTGTGAAAGTTCCAAGATTGTAAAAGCTATATAATTATTAATATATTTGTTTCAACATTGTTAATAA

AAATTTAACTTT
Translation
MADQESDAFDQIVEEESSSDE GWSQTEVETACSSISEVEEPQEKMEPAKMAPIKNAPRDAL VMAQILKDMGITEYEPRVINQMLEFAFR RYVTTILD

DAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRD FLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLVKK GPNQGRLVPRLSAVS

SRPTTPPVA APPQAVSGPNKAATPVSVTSQRFAVQIPPSQSTPAKPA - UNI8815 - APAATAVQNVLINPSMIGPKNILITTSMVSSQNTATDSN

PLKRKHDDDDDNDTM

For any suggestions or comments, please send an email to unitrap@crg.es