Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047257 (BC107230)
Chromosomal location
Chr 9: 110737092 - 110743813 (+)
Description
Inactive testis serine protease 5 Precursor (Trypsin-like protease p98) [Source:UniProtKB/Swiss-Prot;Acc:Q8K4I7]
RefSeq_dna
NM_153172 
RefSeq_peptide
NP_694812.1 
UniGene
Mm.79114 
MGI
MGI:3605764 
Uniprot/SWISSPROT
Q8K4I7 
Human Ortholog
ENSG00000188086 (AC134504.2)
Omim not available
UniTrap UNI35932
Vector Insertion
Chr 9: 110737244 - 110738569
Public Clones IST11040F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27751
Vector Insertion
Chr 9: 110738597 - 110740924
Public Clones IST13140G9 (tigm) IST12858H4BBF1 (tigm)
Private Clones OST50503 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24438
Vector Insertion
Chr 9: 110741073 - 110741525
Public Clones not available
Private Clones OST220653 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27031
Vector Insertion
Chr 9: 110741801 - 110742890
Public Clones not available
Private Clones OST77570 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000011391
Sequence
AGCACGCCGCAGCTATCTCTGCTGCCCTTAGGGACAATATTCATGTATGGCTACGTCATTGCGCGGCCTGGACGCTGGGCCTGGATCCTTGAGGCGCTGG

ATCCTAATCTGCTTTGCGGCGCTACTGTTGCTGCCTCCGCGGCCAAACTTAG - UNI35932 - GTTATAATGAGAACTACACCGAACCAG - UNI2

7751 - TTTGTGGCACACCCTGGTGGCCAGACAACTTGGAGGAGAGCCACCACTGGCCCTGGGAAGCGAGCCTTCAGATAGAAGATAAGCACGTGTGTG

GAGGAGCCCTCATTGATCGAAGCTGGGTGGTGTCTGCGGCTCACTGCATCCAGGG - UNI24438 - CAACAAGGAGTACTCAGTGATGTTGGGTAGC

AGCACCCTCCACCCCAACGGCTCCTCCTGGACCCTGAAGATTCCCGTGGGTGACATCATTATTCATCCCAAGTACTGGGGCCGGAACTTCATCAGAAGCG

ACATTGCCCTTCTCTGCCTTGAAACCCCTGTCACTTTCAACAAGTACGTGCAGCCCATCTGTCTCCCAGAGCACAACTTCAACTTCAAGGTCGGGACGAA

GTGCTGGGTGACTGGCTGGGGCCAGGTTAAGCAGCACTCCTCAG - UNI27031 - CCCAGTTGACACCGGCTCCAGAGCTTTGGGAAGCTGAGGTAT

TCATTATAGACAACAAGAATTGTGACAGCATTTTCCACAAGAAGACCTTGTATCCCCAAGTTGTCCCCCTTATCCGGAAGAACATGATCTGTACCACCAA

TTATGGGGAGGACTTGTGCTAT GGAGACCCCGGGGGGCCATTGGCTTGTGAGATCGATGGCAGATGGATTCTGGCTGGGGTATTCTCATGGGAGAAGGC

CTGCGCCACAGTACCGAATCTAAGTGTATACACCCGTATCACCAAATATACCATATGGATCAAGGACCAAGTGAGCCATGGGGCGCAGCTGGGGCCCTGC

AGGACCTCCTGGCTTCTTCTCCTGCCCTGGCTGCTGCAGCTCCCAGTGAGCCTATGACTTCCCATCCCCTCTTCCTCTTCCTGTTTTGCATGGTGGCCTG

TCCATATCCCACAGTCAGGGTGGCAACGGAATGGTCCCTGGAGAACTTGGGTCCTGCTTTGTCATCCTGGCAGGGAGGGCTGTGGTGGGTTACTGGGCCT

CGCTTGACTGACCAGGAGAAGTGGGGGATTGCTCAGGAGCAGCATTTTGGAATTTAAGACCAAGAGCAGAGATTAAATTTGTGTTAGC
Translation
MATSLRGLDAGPGSLRRWILICFAALLLLPPRPNLG - UNI35932 - GYNENYTEPV - UNI27751 - VCGTPWWPDNLEESHHWPWEASLQIE

DKHVCGGALIDRSWVVSAAHCIQG - UNI24438 - GNKEYSVMLGSSTLHPNGSSWTLKIPVGDIIIHPKYWGRNFIRSDIALLCLETPVTFNKYVQ

PICLPEHNFNFKVGTKCWVTGWGQVKQHSSA - UNI27031 - AQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLCY

 GDPGGPLACEIDGRWILAGVFSWEKACATVPNLSVYTRITKYTIWIKDQVSHGAQLGPCRTSWLLLLPWLLQLPVSL

For any suggestions or comments, please send an email to unitrap@crg.es