Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047368 (5730446C15Rik)
Chromosomal location
Chr 19: 21727799 - 21760127 (+)
Description
family with sequence similarity 108, member B Gene [Source:MGI Symbol;Acc:MGI:1917816]
RefSeq_dna
NM_146096 
RefSeq_peptide
NP_666208.2 
UniGene
Mm.28796 
MGI
MGI:1917816 
Uniprot/SWISSPROT
Q7M759 
Human Ortholog
ENSG00000107362 (FAM108B1)
Omim not available
UniTrap UNI2811
Vector Insertion
Chr 19: 21728084 - 21752842
Public Clones (sanger) AG0493 (sanger) D144C09 (ggtc) D028D08 (ggtc) D014H07 (ggtc)
IST12295D7 (tigm) IST14476F9 (tigm) IST12387D5HMF1 (tigm) IST15058C2 (tigm)
IST14663G4 (tigm) IST14885F7 (tigm) IST14331A3 (tigm) IST11189B9 (tigm)
IST13039B9 (tigm)
Private Clones OST467701 (lexicon) OST467474 (lexicon) OST464068 (lexicon) OST454931 (lexicon)
OST430239 (lexicon) OST402440 (lexicon) OST390725 (lexicon) OST323637 (lexicon)
OST318815 (lexicon) OST315156 (lexicon) OST310570 (lexicon) OST303464 (lexicon)
OST274795 (lexicon) OST274295 (lexicon) OST246252 (lexicon) OST237626 (lexicon)
OST230394 (lexicon) OST215988 (lexicon) OST205239 (lexicon) OST200448 (lexicon)
OST190971 (lexicon) OST190465 (lexicon) OST187944 (lexicon) OST179911 (lexicon)
OST174870 (lexicon) OST173997 (lexicon) OST166943 (lexicon) OST126910 (lexicon)
OST124820 (lexicon) OST85300 (lexicon) OST73084 (lexicon) OST56960 (lexicon)
OST55642 (lexicon) OST54639 (lexicon) OST45478 (lexicon) OST43645 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052556
Sequence
GGTGCCAAGGAAGGCGGGCTGCGGAGAAGGCAGCACCGGCCCTGCGCTGCGGACGGCGACCACGGCCGCGCGGGACCTCGGGCCGGAGAGCCCCGGCGGC

GGCCGCCCCTCGCGGCGGAGCCGTTAGTCAGCAGAACGCGAACGCGCGTGGAGGGGCCCCACGAAGCGCGCCCGGGCACCGCAGCTCTCTTTCGCGTCCT

CGCCGGGCCGGGCCGCGGGCGCAGAGTCGGCGGGCGGCGCCCCGCGGAGGACAGCGCGTTGGCGGCCGCGGCCGCCCAGCTGCAG - UNI2811 - AA

GATGAATAATCTGTCATTTAGTGAGCTATGTTGCCTCTTCTGCTGTCCACCTTGCCCAGGGAAAATTGCTTCAAAACTAGCATTCTTGCCACCTGATCCA

ACTTACACACTGATGTGTGATGAAAGTGGAAGCCGCTGGACCTTACACCTGTCAGAGCGAGCAGACTGGCAGTACTCGTCCCGAGAAAAAGATGCTATTG

AGTGTTTCATGACAAGAACCAGTAAAGGCAACAGAATTGCTTGTATGTTTGTGCGTTGTTCACCAAATGCTAAGTATACCTTACTCTTCTCACATGGAAA

TGCTGTTGATCTTGGTCAGATGAGCAGTTTTTATATAGGTCTGGGTTCCCGCATTAATTGTAACATATTCTCCTATGACTACTCCGGATATGGTGCTAGT

TCTGGAAAGCCAACAGAGAAGAACCTGTATGCAGATGTGGAAGCTGCCTGGCTGGCTCTTCGGACAAG ATACGGCATTCGTCCTGAAAATGTGATTATA

TATGGCCAGAGCATAGGGACAGTGCCATCTGTGGACCTGGCTGCTCGCTATGAGAGTGCTGCTGTTATTCTTCATTCTCCTCTCACCTCAGGAATGCGAG

TTGCTTTCCCTGATACTAAGAAGACCTACTGTTTTGATGCATTCCCAAA CATTGACAAAATCTCTAAGATAACCTCTCCAGTATTAATAATTCACGGGA

CTGAAGATGAAGTCATTGACTTTTCCCATGGCCTCGCATTGTTTGAGCGCTGCCAAAGACCTGTGGAGCCCCTGTGGGTTGAAGGGGCAGGACACAATGA

CGTGGAGCTTTATGGACAATACCTTGAGAGGTTAAAACAGTTCGTGTCACAGGAACTGGTAAATTTGTAAACTACTCTGTAAATTTGCAGACTGGGTTTT

CTTTTCTTGCTGAACTGCACTCCTTGGTAAATAACATAAAACCTGAAGGTTTTGTTTACAAATCATGTAAGTTGCCTTCATAACTGTACAGGTAATGATT

TGTTAACAGACTTAATGAAGGTTTTAATTACCATAACTTGAAACTGGAAATAGCAGTATCATGCAGTCAGGCTGTGTAATTTATATTTTTTCTGTGAATT

TTTTTTAAACATCAAGATGAGTACTGTATGAAATTTTAATTCTATAAAATCAAATGCTGTAAAAGTATTGTCAAATGCTTTTGCATATCAAAAGCAAATT

TATAAATATTTTTAAACATCTCAATGTACTAAATATCCTGGTATACAAATGTAATATTCTTTCAAAAAGCTGTATATCTAAAGCAATTCAAGTACTCAGA

ATAAACTGTAAAAAACAAAACGGTTTGAAAACATCCAAATTGAGTTGATATATACTCCACTGTACAGGGATAGAGGCTTAAATGGTTATTTTATTGTTAA

AAAAAATGCATTGACTTTTCTGTATTCTCCAATTATAGTACATTTATCCTTTAAAAAAATGAAGTCTTAATTTTTATGCCATCTGTTAACTTAGCAGCTC

TTCATCCTGTCACTGAGAAGTCCTGATGGCGCTGGATTTTAACTAGTTCTGACTTATGTTTGGTACTGTGAGACAACTACTTAACATTTTCATTCAGTTA

TTTAAAGGACAGTTAGGGCTTCAAGAATGATTTTGTATGCAATGTTGTTTTAAATTTGACTAATTATTAGAACTGTAGTAGTCTTCCTTATATGAATACT

TGAAACTCCGTTAGTTGATCTTCAAGACCACAGAGAGACTGGCTGTTTGGTTCCTTTCCACCTCTGCTGTTTTTAAGAGTAGGGCCTGTTCTTTTGGAGT

AGTATCTGAGAATGTCATGGGTTCCCTCCTGAATGCAGGGGATAAGAAAACATGCCATACATTTTATATTAACCAGTATAGTAAAAAAAATAAAATAAAT

AAATAAAGCTCACACACAAAAACTAAGTTGCCTTTCCTTGAATGAATCCTGCCTGAAAAATGAAAGAAAAATAAAAAATAAACTAATGGTATATAGTCTT

AATTTGTAATGAATGAGAATCAAAATAATACACACTGTGGATATGTTTTTAAGGCCTTATGTAATTTTAATTGTTCTGCTTGTTCTGTGGTTATGTCTAA

GATTATAGTACACGATCTTCAAAGTATATCAAATATTGTGAATCCTTTGGTTCAGCTATGTCAAATTCACAGTAAAACAACAAATGTACC
Translation
 - UNI2811 - MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFMTRTSKGNRIACMFVRCS

PNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADVEAAWLALRTR RYGIRPENVIIYGQSIGTVPSVDLAARYES

AAVILHSPLTSGMRVAFPDTKKTYCFDAFPN NIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQ

ELVNL

For any suggestions or comments, please send an email to unitrap@crg.es