Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047407 (Tgif1)
Chromosomal location
Chr 17: 71193551 - 71202886 (-)
Description
TGFB-induced factor homeobox 1 Gene [Source:MGI (curated);Acc:Tgif1-003]
RefSeq_dna
NM_009372 
RefSeq_peptide
NP_033398.2 
UniGene
Mm.472392 
MGI
MGI:1194497 
Uniprot/SWISSPROT
P70284 
Uniprot/SPTREMBL
Q3TVD4 
Human Ortholog
ENSG00000177426 (TGIF)
Omim 142946 - HOLOPROSENCEPHALY 4  
UniTrap UNI10834
Vector Insertion
Chr 17: 71201075 - 71202787
Public Clones (sanger) P067A01 (ggtc) F032F01 (ggtc) D037G01 (ggtc) PST22816-NR (escells)
IST14148C12 (tigm) IST10407G1 (tigm) IST12317A10 (tigm) IST14140C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37667
Vector Insertion
Chr 17: 71200211 - 71201075
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10902
Vector Insertion
Chr 17: 71195739 - 71200211
Public Clones (sanger) P109A03 (ggtc) 5SP140F12 (ggtc) 3SD006A11 (ggtc) 5SD029G07 (ggtc)
3SD144C07 (ggtc) 5SD010D04 (ggtc) 3SD039C02 (ggtc) 5SP119G07 (ggtc)
3SD029G07 (ggtc) 3SD080F05 (ggtc) D037B02 (ggtc) 5SD006A11 (ggtc)
3SD039B07 (ggtc) 3SP119G07 (ggtc) 5SE040A03 (ggtc) PST10520-NR (escells)
IST14958G9 (tigm) IST12478C5 (tigm) IST14227G1 (tigm) IST13698G4 (tigm)
IST14630A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16533
Vector Insertion
Chr 17: 71195511 - 71195739
Public Clones not available
Private Clones OST459045 (lexicon) OST456801 (lexicon) OST456789 (lexicon) OST443830 (lexicon)
OST430736 (lexicon) OST379723 (lexicon) OST374227 (lexicon) OST314997 (lexicon)
OST309439 (lexicon) OST289646 (lexicon) OST248923 (lexicon) OST248228 (lexicon)
OST215348 (lexicon) OST214554 (lexicon) OST209713 (lexicon) OST207447 (lexicon)
OST204118 (lexicon) OST200943 (lexicon) OST194298 (lexicon) OST189317 (lexicon)
OST174854 (lexicon) OST137760 (lexicon) OST132283 (lexicon) OST130594 (lexicon)
OST130233 (lexicon) OST116821 (lexicon) OST113225 (lexicon) OST56094 (lexicon)
OST35480 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18777
Vector Insertion
Chr 17: 71193551 - 71194613
Public Clones not available
Private Clones OST414491 (lexicon) OST316074 (lexicon) OST209660 (lexicon) OST184586 (lexicon)
OST139103 (lexicon)
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118283
Sequence
AGAATTCCGCCAGCGCGCTCCGACTTCTTAACTGCCTCGAAAAGATTTATGCGAGCAGAAGGTGTGCACTGGCGGAGTTCAGCTGGCCTTCGCGTCACG 

- UNI10834 - - UNI10902 - - UNI16533 - GTCTTGTTGCAGCATCTGGCAGTGACTCTGAGGATGAAGACAGCATGGACAGTCCCCTGGA

CCTTTCCTCATCAGCAGCCTCTGGCAAGAGAAGGAGGAGAGGCAATCTGCCCAAGGAGTCAGTCCAGATTCTGCGAGACTGGCTGTATGAACACAGATAC

AACGCCTATCCCTCAGAGCAAGAGAAAGCACTGCTGTCCCAGCAGACACACCTGTCCACACTACAG - UNI16533 - - UNI18777 - GTCTGTA

ACTGGTTCATCAACGCCCGCCGCAGGCTCCTTCCTGACATGCTGAGAAAGGATGGCAAAGATCCAAATCAGTTCACGATTTCCCGCCGTGGGGCCAAGAT

TTCAGAAGCTAGCTCTATTGAAGCTGCAATGGGTATCAAAAACTTCATGCCAACTCTAGAAGAGAGCCCATTTCATTCCTGCGTAGTTGGACCCAACCCA

ACCCTAGGGAGACCAGTGTCTCCCAAACCTCCCTCCCCAGGATCCATTTTGGCTCGCCCGTCAGTGATCTGCCATACCACTGTGACTGCATTGAAGGATG

GGCCTTTCTCTCTCTGTCAGCCGATTGGTGTGGGACAGAGTACAGATGTACCGCAAATAGCACCCAGCAACTTTACAGACACCTCTCTCGTGTACCCAGA

GGACACTTGCAAATCTGGACCCAGTCCAAACCCTCAGAGTGGTCTTTTCAACACTCCTCCCCCTACTCCACCAGACCTCAACCAGGATTTTAGTGGATTC

CAGCTTCTAGTGGATGTTGCACTCAAACGAGCGGCAGAGATGGAGCTTCAGGCCAAACTCACAGCTTAACCGTTTTTTCAAACAAAACAGTTCTCCAAAA

TACGGTCCTGATTGCCGGGGGTGATGGCAAGAGATGCATTATTTTATATATTTTTCTATTAATATTTGCACATGGGATTGCTCAGACGAAGCTTCCTGTT

ACTAAGATGTCTTAAGTGGAATAGAGTCATTCCAAGAACTACAAACTAAAGCTACTGTAGAAACAAAGGGTTTTCTTTTCGAATGTTTCTTGGTAGTTTC

TCATAATGTGAGACGGTTCCCAGTATCATGTGATCTTCTCCTCCAGACTCCTCTTCTTTATGTTCCAAGACTGTGCAATACTTTAGACGCCCTCGCACCT

CTCTCTTCCCATGTGGAATGGGACGCCCACCTACAGTCTAATGAGTAAACTTTCAGTTTTTTGTTTGTTTGTTTTTTTTTAGATTCAAGCAAGTATGAAT

CTAGTTGTTGGATACCTTTTTTCATGATGTAATAAAGTATTTTCTTTAAAAG
Translation
 - UNI10834 - - UNI10902 - - UNI16533 - MDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTL

Q - UNI16533 - - UNI18777 - VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLG

RPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLL

VDVALKRAAEMELQAKLTA
Transcript ENSMUST00000117294
Sequence
GCGCTGTGCCGCGCCCGCGTGTCAATGGCAGCTGCGCCTTCTGGAAGAAGTTGATTCTTGTCTGGAATACTTTTCCTTCGGTGCCCCACCCCTTGAATCA

GAAGCTGCTGCCTCCGGCGGCTGGAGCAGAGACAGTGAAGTTTGGGGCAGCTGTCAAAAACAAGGATGGGGGTGTCTTTTCTTCTCTGGGGTGGACAGAG

GAGATGTCCTTAAACCTCTCTCCATCCTTTACAAACTAAATGCACTCTTCGCTAGCCCGGGGAGGAAAGGCCCCAAAAGAGAAACCAGTGTGGCCGCTGA

GAGCTGAGGGATGGAGATGGTGCTCTCGCCACGGGCAGGCAGGCATGACCCTGCTTCTGGGTTCCGCCAGCGCGTAGAGGGACGGGTGATCTCGGCCCCC

AGGCCCAGGGTTGTGGAGCTGGAAG - UNI10902 - - UNI16533 - GTCTTGTTGCAGCATCTGGCAGTGACTCTGAGGATGAAGACAGCATGG

ACAGTCCCCTGGACCTTTCCTCATCAGCAGCCTCTGGCAAGAGAAGGAGGAGAGGCAATCTGCCCAAGGAGTCAGTCCAGATTCTGCGAGACTGGCTGTA

TGAACACAGATACAACGCCTATCCCTCAGAGCAAGAGAAAGCACTGCTGTCCCAGCAGACACACCTGTCCACACTACAG - UNI16533 - - UNI18

777 - GTCTGTAACTGGTTCATCAACGCCCGCCGCAGGCTCCTTCCTGACATGCTGAGAAAGGATGGCAAAGATCCAAATCAGTTCACGATTTCCCGCC

GTGGGGCCAAGATTTCAGAAGCTAGCTCTATTGAAGCTGCAATGGGTATCAAAAACTTCATGCCAACTCTAGAAGAGAGCCCATTTCATTCCTGCGTAGT

TGGACCCAACCCAACCCTAGGGAGACCAGTGTCTCCCAAACCTCCCTCCCCAGGATCCATTTTGGCTCGCCCGTCAGTGATCTGCCATACCACTGTGACT

GCATTGAAGGATGGGCCTTTCTCTCTCTGTCAGCCGATTGGTGTGGGACAGAGTACAGATGTACCGCAAATAGCACCCAGCAACTTTACAGACACCTCTC

TCGTGTACCCAGAGGACACTTGCAAATCTGGACCCAGTCCAAACCCTCAGAGTGGTCTTTTCAACACTCCTCCCCCTACTCCACCAGACCTCAACCAGGA

TTTTAGTGGATTCCAGCTTCTAGTGGATGTTGCACTCAAACGAGCGGCAGAGATGGAGCTTCAGGCCAAACTCACAGCTTAACCGTTTTTTCAAACAAAA

CAGTTCTCCAAAATACGGTCCTGATTGCCGGGGGTGATGGCAAGAGATGCATTATTTTATATATTTTTCTATTAATATTTGCACATGGGATTGCTCAGAC

GAAGCTTCCTGTTACTAAGATGTCTTAAGTGGAATAGAGTCATTCCAAGAACTACAAACTAAAGCTACTGTAGAAACAAAGGGTTTTCTTTTCGAATGTT

TCTTGGTAGTTTCTCATAATGTGAGACGGTTCCCAGTATCATGTGATCTTCTCCTCCAGACTCCTCTTCTTTATGTTCCAAGACTGTGCAATACTTTAGA

CGCCCTCGCACCTCTCTCTTCCCATGTGGAATGGGACGCCCACCTACAGTCTAATGAGTAAACTTTCAGTTTTTTGTTTGTTTGTTTTTTTTTAGATTCA

AGCAAGTATGAATCTAGTTGTTGGATACCTTTTTTCATGATGTAATAAAGTATTTTCTTTAAAAGTTA
Translation
 - UNI10902 - - UNI16533 - MDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQ - UNI16533 

- - UNI18777 - VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSI

LARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMEL

QAKLTA
Transcript ENSMUST00000059775
Sequence
CACTCTGACAGCGCCGAGGTGCGCCGAGTGGAGCGGGAAACAAAGGAGCTGAGTAGGGAGGGAGGGAATTGGGCCAGGGAGAACCCCCGGCTGGCTGCCA

GAAGATCCCGACTGGAGGAAGCCCAAGTGTCACTTGAATTCCAACCCAGAAGCCAGCGCCTGAGACCGGAGCACCTTGTTTAGCAATAGTGGTTGGAACA

CTCTCTTGTAAGTTACCGGAGCACTAGTATAGGAGGAGGATCATCGACTACCCTCCCGCCACTCCACGGCTGCTGGCTCCTAGAAACCCCAGCTTCACCT

CTCACTGGGACTCGAGTTCCAGAATGAAAAGCAAGAAGG - UNI10902 - - UNI16533 - GTCTTGTTGCAGCATCTGGCAGTGACTCTGAGGA

TGAAGACAGCATGGACAGTCCCCTGGACCTTTCCTCATCAGCAGCCTCTGGCAAGAGAAGGAGGAGAGGCAATCTGCCCAAGGAGTCAGTCCAGATTCTG

CGAGACTGGCTGTATGAACACAGATACAACGCCTATCCCTCAGAGCAAGAGAAAGCACTGCTGTCCCAGCAGACACACCTGTCCACACTACAG - UNI1

6533 - - UNI18777 - GTCTGTAACTGGTTCATCAACGCCCGCCGCAGGCTCCTTCCTGACATGCTGAGAAAGGATGGCAAAGATCCAAATCAGTT

CACGATTTCCCGCCGTGGGGCCAAGATTTCAGAAGCTAGCTCTATTGAAGCTGCAATGGGTATCAAAAACTTCATGCCAACTCTAGAAGAGAGCCCATTT

CATTCCTGCGTAGTTGGACCCAACCCAACCCTAGGGAGACCAGTGTCTCCCAAACCTCCCTCCCCAGGATCCATTTTGGCTCGCCCGTCAGTGATCTGCC

ATACCACTGTGACTGCATTGAAGGATGGGCCTTTCTCTCTCTGTCAGCCGATTGGTGTGGGACAGAGTACAGATGTACCGCAAATAGCACCCAGCAACTT

TACAGACACCTCTCTCGTGTACCCAGAGGACACTTGCAAATCTGGACCCAGTCCAAACCCTCAGAGTGGTCTTTTCAACACTCCTCCCCCTACTCCACCA

GACCTCAACCAGGATTTTAGTGGATTCCAGCTTCTAGTGGATGTTGCACTCAAACGAGCGGCAGAGATGGAGCTTCAGGCCAAACTCACAGCTTAACCGT

TTTTTCAAACAAAACAGTTCTCCAAAATACGGTCCTGATTGCCGGGGGTGATGGCAAGAGATGCATTATTTTATATATTTTTCTATTAATATTTGCACAT

GGGATTGCTCAGACGAAGCTTCCTGTTACTAAGATGTCTTAAGTGGAATAGAGTCATTCCAAGAACTACAAACTAAAGCTACTGTAGAAACAAAGGGTTT

TCTTTTCGAATGTTTCTTGGTAGTTTCTCATAATGTGAGACGGTTCCCAGTATCATGTGATCTTCTCCTCCAGACTCCTCTTCTTTATGTTCCAAGACTG

TGCAATACTTTAGACGCCCTCGCACCTCTCTCTTCCCATGTGGAATGGGACGCCCACCTACAGTCTAATGAGTAAACTTTCAGTTTTTTGTTTGTTTGTT

TTTTTTTAGATTCAAGCAAGTATGAATCTAGTTGTTGGATACCTTTTTTCATGATGTAATAAAGTATTTTCTTTAAAAGTT
Translation
MKSKKG - UNI10902 - - UNI16533 - GLVAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLS

QQTHLSTLQ - UNI16533 - - UNI18777 - VCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCV

VGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQ

DFSGFQLLVDVALKRAAEMELQAKLTA

For any suggestions or comments, please send an email to unitrap@crg.es