Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047412 (CT025653.7-201)
Chromosomal location
Chr 9: 30838229 - 30877844 (+)
Description
Zinc finger and BTB domain-containing protein 44 (BTB/POZ domain-containing protein 15) [Source:UniProtKB/Swiss-Prot;Acc:Q8R0A2]
RefSeq_dna
NM_172765 
RefSeq_peptide
NP_001108602.1 NP_766353.2 
Uniprot/SWISSPROT
Q8R0A2 
Uniprot/SPTREMBL
Q3TRW7 
Human Ortholog
ENSG00000196323 (ZBTB44)
Omim not available
UniTrap UNI14180
Vector Insertion
Chr 9: 30838544 - 30860824
Public Clones (sanger) 3SP143G04 (ggtc) 5SD048A06 (ggtc) 3SP143G09 (ggtc) 5SD074B04 (ggtc)
5SE288C03 (ggtc) 3SD048A06 (ggtc) 5SP143G04 (ggtc) 3SD074B04 (ggtc)
3SE288C03 (ggtc) 5SE069D03 (ggtc) CMHD-GT_45A1-3 (cmhd) CMHD-GT_534A7-5S (cmhd)
IST14504F6 (tigm) IST14663E3 (tigm) IST14538A8 (tigm) IST13643B2 (tigm)
IST11089F6 (tigm) IST14976D3 (tigm) IST11451G12 (tigm) IST14643G12 (tigm)
Private Clones OST123255 (lexicon) OST123189 (lexicon) OST43465 (lexicon) OST43381 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19
Vector Insertion
Chr 9: 30861899 - 30869625
Public Clones GC0257 (tigem) CSA060 (baygenomics) W077D05 (ggtc)
Private Clones OST426850 (lexicon) OST279609 (lexicon) OST68154 (lexicon) OST38554 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30306
Vector Insertion
Chr 9: 30869711 - 30871817
Public Clones D024C06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23089
Vector Insertion
Chr 9: 30871763 - 30871928
Public Clones not available
Private Clones OST276852 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25476
Vector Insertion
Chr 9: 30871928 - 30874243
Public Clones not available
Private Clones OST182507 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115220
Sequence
TTCCGGTGCCAGATATGTAGTGCCACTTTCACTTCCTTCGGGGAGTATAAACACCACATGAGGGTTTCCCGGCACATTATCCGCAAGCCTCGGATTTACG

AGTGCAAAACATGTGGCGCCATGTTCACCAACTCTGGAAATTTAATCGTGCACCTGAGGAGTCTGAACCATGAAGCATCAGAGCTAGCAAACTACTTCCA

GAGCAG TGATTTCTTAGTACCGGACTACTTAAACCAGGAGCAAGAAGAGACCCTTGTTCAGTATGATCTTGGAGAACATACTTTTGAAAGCAACTCTTC

TGTTCAAATGCCTGTGATTTCACAGGTCTCCTCAACCCAGAATTGTGAAAGCACTTTTCCCCTGGGCTCTCTTGGTGGGCTTACAGAGAAGGAGGAGGAA

CTGCATGAGCAGCCAAAGACCAGTGCTCCTGCTGAGGCGCCCAGGGATGACCCCCCTAAGGCAGAGCTGCCTGCTATAACTATTGAGTAATTCTGTGATT

GGCCTGGGGTTTGGTTTTTTGGAAAGTGCCTGTGCTTGGTCTCATATGTTTAAATTTAATTTAATTTTTAAAGAAGGGTTCCCTTTGTAAACCCTAAAAC

TGGAGGGTTCTATGTTTTGTTTTGTTTTTTCATAGCTGAGAGATTGCTTCTGTATGTATACAATAAGGTAACATTGAAACAGAACATAAACTTTGAGACT

TAAGGAAAAGCAGCTGACTTAGAACATGGCAGTTCTTCCTCCCATTGTTAAAAGTGGGCAGCAGCAGATACAAAAGAACTCAGGCTGTGGTTGACCTTCC

TGAGAGAAGAGGGCTAATGAGAAGTTATTAAACAGTTTGACAAGGCCTAAGTAAATGTGTACTCCTAAGTGCAGGGTGTTATAAACCCTGTAGTTTTGGA

AGTATTTGTGGTGGGTTTGTTTTTGTTTTTGTTTTTTTCAGATGAAGGTAAATAACTTCTGAAATCCAGTATATTCTTTTTTAAGCCATTTTGAATTTTC

ATAGTGAAAAATTAGTATCAGGCAGGTATTTCCTGTACCTTTATAGCACCACTCCAGAGGCTAAGAGGTGTGGTTGAGAAGAGTCAGGCTGCATGTGGAA

TGGCAGGGTGCAGAACGAGGTACGTATACCCAGCTTTGCAGAAACTCTCCTGAGACTTTCTCTTCCTGGTCATTGAATGCTGACACCTGGCTAACTAGGG

CATTGCTCAGAGAAGTGTCCTCGTGTCCCACCAACAGCACTTTCATTTGCATATACTATTGTGCTGCCATATAAAGGAGAAATAGTGAAGATATTCTATA

TTTTATATATAGGTTTATGTATTGTTGAGGATGTCGATGCTGTGCTGTTTTGGACAAAATAAAAGAATTCTGTTTTGAGGCTACATTCTTAACCCAATTA

AGATTGTTTACAAGGTCACATATGACAACAATATAATGTCCTTATTCCAAAATATTTTGAGGTATTGCCAAGTTTGTTAAAAGCTTTCACGAGATGTAAG

CAATAATGTAAAAGATACGACGAGGTTGTGAGTGATCATCTGTGACTCAGACATGGAGGGAGGGATTGTTAAGACCAGAATCTTAAAAACTTTGCTACTC

AGACGATAACATTTATATGATATTCTAGATTGGGATATACTTTTTTATCTTTTGCCATTAAAGCCTCTTTGATCTAAAATATTTATGAAGCCACGAGTAA

TGAACTTTTGTGTAATTTTTTA
Translation
FRCQICSATFTSFGEYKHHMRVSRHIIRKPRIYECKTCGAMFTNSGNLIVHLRSLNHEASELANYFQSS SDFLVPDYLNQEQEETLVQYDLGEHTFESN

SSVQMPVISQVSSTQNCESTFPLGSLGGLTEKEEELHEQPKTSAPAEAPRDDPPKAELPAITIE
Transcript ENSMUST00000061588
Sequence
TCAGGCCCACGGGCGCCCGGCGCTCTCCTCGCGCCTCGCACTCTCGCACCTCGCGGCCACGCGGGTGAGTGGCGCCGCCATGCGCGCCCAGTCCCAGGCT

GCACACTGGCCTAGGAGCGGCGGCCCGAGATAGGGTCCCCTGAGCCTCCCGGGGGAGGAGAGGAGCCAGTCGCGCGCTCCGCCCCCTCCCCCCGGGTTGC

CGCCACCGCCGCTGCCTCCGCCACCGCCACAGCCACCGCCACCTCGCCGCCCCAGCCTGGCGGGGAAGAGGAGGAGCAGTTGCAGGCCTCCGGGCCTCGG

CACCGCCGCCCGCAG - UNI14180 - GATAATTCAGATTCATTGCATCCTTGAAGAGCATCAATAGAAGAGGGAAAAAAAAGATGGGTGTGAAAACA

TTTACTCACAGCTCCTCTTCCCACAGCCAGGAAATGCTGGGGAAACTAAATATGCTCCGAAATGATGGACATTTTTGTGATATCACTATTCGTGTCCAGG

ACAAAATCTTCCGGGCTCACAAGGTAGTACTAGCAGCTTGCAGTGATTTCTTTCGAACCAAACTTGTTGGCCAAACAGAAGATGAGAACAAAAATGTGTT

GGATCTGCATCATGTTACAGTGACTGGCTTTATACCTCTTTTAGAATACGCTTACACAGCCACTCTGTCAATTAACACGGAAAATATTATTGATGTTCTA

GCGGCAGCCAGCTATATGCAAATGTTTAGTGTTGCTAGTACATGCTCAGAGTTCATGAAGTCAAGTATTTTGTGGAATACACCTAATAGCCAACCAGAAA

AGAGTCTAGATGCTGGACAAGAAAATAGCTCCAACTGCAATTTTACTTCTCGAGATGGAAGCATTTCTCCAGTGTCTTCAGAGTGCAGTGCTGTGGAGAG

GACCATTCCTGTCTGCCGAGAGTCCCGGAGGAAGCGCAAAAGCTACATTGTTATGTCTCCCGAGAGTCCCGTGAAATGTAGCACCCAAACAAGTTCCCCC

CAGGTACTGAATTCTTCAGCTTCCTATGCAGAAAATAGAAGTCAGCCAGTTGACTCTTCTTTAGCTTTTCCTTGGACTTTCCCTTTTGGAATAGATCGAA

GGATTCAGCCTGAGAAAGCAAAGCAGGCAGAAAATACCCGGACTTTAGAATTGCCTGGCCCATCCGAGGCAGGTAGAAGAGTGGCTGACTATGTGACTTG

TGAGAGCACAAAACCCACCTTGCCTCTAGGTACAGAAGAAGATGTCCGGGTCAAAGTAGAAAGATTAAGTGATGAGGAGGTCCATGAGGAAGTGTCCCAG

CCTGTTAGTGCATCTCAGAGCTCACTGAGTGATCAGCAGACAGTGCCCGGAAGTGAACCAGTTCAAGAGGACCTTCTGATCAGTCCACAGTCTTCCTCTA

TAG - UNI19 - GCTCAGTAGATGAAGGAGTCACTGAAGGATTGCCTACACTTCAGAGCACCTCTAGCACCAATGCTCATGCAGATGACGATGACAG 

- UNI23089 - - UNI30306 - ATTGGAAAATGTTCAGTATCCCTATCAACTCTACATTGCTCCTTCTACCAGCAGTACAGAGCGGCCAAGTCCAA

ATGGTCCAGACAGACCGTTTCAGTGTCCAACCTGTGGGGTCCGCTTCACCCGTATTCAGAATCTAAAACAGCACATGCTTATCCACTCAG - UNI2308

9 - - UNI25476 - GAATTAAACCATTTCAGTGTGACTGCTGTGGAAAAAAGTTTACCAGGGCTTACTCGCTAAAGATGCATCGCCTAAAGCACGAA

G ATATCTCC
Translation
 - UNI14180 - MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKLVGQTEDENKNVLDLHHVTVTGFIPLL

EYAYTATLSINTENIIDVLAAASYMQMFSVASTCSEFMKSSILWNTPNSQPEKSLDAGQENSSNCNFTSRDGSISPVSSECSAVERTIPVCRESRRKRKS

YIVMSPESPVKCSTQTSSPQVLNSSASYAENRSQPVDSSLAFPWTFPFGIDRRIQPEKAKQAENTRTLELPGPSEAGRRVADYVTCESTKPTLPLGTEED

VRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVPGSEPVQEDLLISPQSSSIG - UNI19 - GSVDEGVTEGLPTLQSTSSTNAHADDDDR - UNI

23089 - - UNI30306 - RLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLIHSG - UNI23089 - - UNI2547

6 - GIKPFQCDCCGKKFTRAYSLKMHRLKHED DIS
Transcript ENSMUST00000115222
Sequence
TCAGGCCCACGGGCGCCCGGCGCTCTCCTCGCGCCTCGCACTCTCGCACCTCGCGGCCACGCGGGTGAGTGGCGCCGCCATGCGCGCCCAGTCCCAGGCT

GCACACTGGCCTAGGAGCGGCGGCCCGAGATAGGGTCCCCTGAGCCTCCCGGGGGAGGAGAGGAGCCAGTCGCGCGCTCCGCCCCCTCCCCCCGGGTTGC

CGCCACCGCCGCTGCCTCCGCCACCGCCACAGCCACCGCCACCTCGCCGCCCCAGCCTGGCGGGGAAGAGGAGGAGCAGTTGCAGGCCTCCGGGCCTCGG

CACCGCCGCCCGCAG - UNI14180 - GATAATTCAGATTCATTGCATCCTTGAAGAGCATCAATAGAAGAGGGAAAAAAAAGATGGGTGTGAAAACA

TTTACTCACAGCTCCTCTTCCCACAGCCAGGAAATGCTGGGGAAACTAAATATGCTCCGAAATGATGGACATTTTTGTGATATCACTATTCGTGTCCAGG

ACAAAATCTTCCGGGCTCACAAGGTAGTACTAGCAGCTTGCAGTGATTTCTTTCGAACCAAACTTGTTGGCCAAACAGAAGATGAGAACAAAAATGTGTT

GGATCTGCATCATGTTACAGTGACTGGCTTTATACCTCTTTTAGAATACGCTTACACAGCCACTCTGTCAATTAACACGGAAAATATTATTGATGTTCTA

GCGGCAGCCAGCTATATGCAAATGTTTAGTGTTGCTAGTACATGCTCAGAGTTCATGAAGTCAAGTATTTTGTGGAATACACCTAATAGCCAACCAGAAA

AGAGTCTAGATGCTGGACAAGAAAATAGCTCCAACTGCAATTTTACTTCTCGAGATGGAAGCATTTCTCCAGTGTCTTCAGAGTGCAGTGCTGTGGAGAG

GACCATTCCTGTCTGCCGAGAGTCCCGGAGGAAGCGCAAAAGCTACATTGTTATGTCTCCCGAGAGTCCCGTGAAATGTAGCACCCAAACAAGTTCCCCC

CAGGTACTGAATTCTTCAGCTTCCTATGCAGAAAATAGAAGTCAGCCAGTTGACTCTTCTTTAGCTTTTCCTTGGACTTTCCCTTTTGGAATAGATCGAA

GGATTCAGCCTGAGAAAGCAAAGCAGGCAGAAAATACCCGGACTTTAGAATTGCCTGGCCCATCCGAGGCAGGTAGAAGAGTGGCTGACTATGTGACTTG

TGAGAGCACAAAACCCACCTTGCCTCTAGGTACAGAAGAAGATGTCCGGGTCAAAGTAGAAAGATTAAGTGATGAGGAGGTCCATGAGGAAGTGTCCCAG

CCTGTTAGTGCATCTCAGAGCTCACTGAGTGATCAGCAGACAGTGCCCGGAAGTGAACCAGTTCAAGAGGACCTTCTGATCAGTCCACAGTCTTCCTCTA

TAG - UNI19 - GCTCAGTAGATGAAGGAGTCACTGAAGGATTGCCTACACTTCAGAGCACCTCTAGCACCAATGCTCATGCAGATGACGATGACAG 

- UNI23089 - - UNI30306 - TACAGAGCGGCCAAGTCCAAATGGTCCAGACAGACCGTTTCAGTGTCCAACCTGTGGGGTCCGCTTCACCCGTA

TTCAGAATCTAAAACAGCACATGCTTATCCACTCAG - UNI23089 - - UNI25476 - GAATTAAACCATTTCAGTGTGACTGCTGTGGAAAAAA

GTTTACCAGGGCTTACTCGCTAAAGATGCATCGCCTAAAGCACGAAG TGATTTCTTAGTACCGGACTACTTAAACCAGGAGCAAGAAGAGACCCTTGTT

CAGTATGATCTTGGAGAACATACTTTTGAAAGCAACTCTTCTGTTCAAATGCCTGTGATTTCACAGGTCTCCTCAACCCAGAATTGTGAAAGCACTTTTC

CCCTGGGCTCTCTTGGTGGGCTTACAGAGAAGGAGGAGGAACTGCATGAGCAGCCAAAGACCAGTGCTCCTGCTGAGGCGCCCAGGGATGACCCCCCTAA

GGCAGAGCTGCCTGCTATAACTATTGAGTAATTCTGTGATTGGCCTGGGGTTTGGTTTTTTGGAAAGTGCCTGTGCTTGGTCTCATATGTTTAAATTTAA

TTTAATTTTTAAAGAAGGGTTCCCTTTGTAAACCCTAAAACTGGAGGGTTCTATGTTTTGTTTTGTTTTTTCATAGCTGAGAGATTGCTTCTGTATGTAT

ACAATAAGGTAACATTGAAACAGAACATAAACTTTGAGACTTAAGGAAAAGCAGCTGACTTAGAACATGGCAGTTCTTCCTCCCATTGTTAAAAGTGGGC

AGCAGCAGATACAAAAGAACTCAGGCTGTGGTTGACCTTCCTGAGAGAAGAGGGCTAATGAGAAGTTATTAAACAGTTTGACAAGGCCTAAGTAAATGTG

TACTCCTAAGTGCAGGGTGTTATAAACCCTGTAGTTTTGGAAGTATTTGTGGTGGGTTTGTTTTTGTTTTTGTTTTTTTCAGATGAAGGTAAATAACTTC

TGAAATCCAGTATATTCTTTTTTAAGCCATTTTGAATTTTCATAGTGAAAAATTAGTATCAGGCAGGTATTTCCTGTACCTTTATAGCACCACTCCAGAG

GCTAAGAGGTGTGGTTGAGAAGAGTCAGGCTGCATGTGGAATGGCAGGGTGCAGAACGAGGTACGTATACCCAGCTTTGCAGAAACTCTCCTGAGACTTT

CTCTTCCTGGTCATTGAATGCTGACACCTGGCTAACTAGGGCATTGCTCAGAGAAGTGTCCTCGTGTCCCACCAACAGCACTTTCATTTGCATATACTAT

TGTGCTGCCATATAAAGGAGAAATAGTGAAGATATTCTATATTTTATATATAGGTTTATGTATTGTTGAGGATGTCGATGCTGTGCTGTTTTGGACAAAA

TAAAAGAATTCTGTTTTGAGGCTACATTCTTAACCCAATTAAGATTGTTTACAAGGTCACATATGACAACAATATAATGTCCTTATTCCAAAATATTTTG

AGGTATTGCCAAGTTTGTTAAAAGCTTTCACGAGATGTAAGCAATAATGTAAAAGATACGACGAGGTTGTGAGTGATCATCTGTGACTCAGACATGGAGG

GAGGGATTGTTAAGACCAGAATCTTAAAAACTTTGCTACTCAGACGATAACATTTATATGATATTCTAGATTGGGATATACTTTTTTATCTTTTGCCATT

AAAGCCTCTTTGATCTAAAATATTTATGAAGCCACGAGTAATGAACTTTTGTGTAATTTTTTA
Translation
 - UNI14180 - MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLAACSDFFRTKLVGQTEDENKNVLDLHHVTVTGFIPLL

EYAYTATLSINTENIIDVLAAASYMQMFSVASTCSEFMKSSILWNTPNSQPEKSLDAGQENSSNCNFTSRDGSISPVSSECSAVERTIPVCRESRRKRKS

YIVMSPESPVKCSTQTSSPQVLNSSASYAENRSQPVDSSLAFPWTFPFGIDRRIQPEKAKQAENTRTLELPGPSEAGRRVADYVTCESTKPTLPLGTEED

VRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVPGSEPVQEDLLISPQSSSIG - UNI19 - GSVDEGVTEGLPTLQSTSSTNAHADDDDS - UNI

23089 - - UNI30306 - STERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLIHSG - UNI23089 - - UNI25476 - GIKPFQCDCCGKKF

TRAYSLKMHRLKHEV VIS

For any suggestions or comments, please send an email to unitrap@crg.es