Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047434 (AI480653)
Chromosomal location
Chr 16: 30955722 - 31081466 (-)
Description
Uncharacterized protein C3orf21 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q3U4G3]
RefSeq_peptide
NP_941028.1 
UniGene
Mm.286693 
MGI
MGI:2146443 
Uniprot/SWISSPROT
Q3U4G3 
Human Ortholog
ENSG00000173950 (C3orf21)
Omim not available
UniTrap UNI10259
Vector Insertion
Chr 16: 31007933 - 31050717
Public Clones (sanger) KST219 (baygenomics) P070E02 (ggtc) G044E04 (ggtc) G077F12 (ggtc)
IST11921F1 (tigm)
Private Clones OST431155 (lexicon) OST360148 (lexicon) OST43570 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10821
Vector Insertion
Chr 16: 30957821 - 31007799
Public Clones P069D11 (ggtc) D024G12 (ggtc) G059A05 (ggtc) G059F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055389
Sequence
TGCTGCTCTGAGTGGGCCCGGCTGCTGGGCCGCCGGCTCCGGCGCATGGGCCTCCTCCGAGGCGGAGCTGCGTGCGCTCGGGCCATGGCGCGCCTGGGCG

CGTTGCGCTCGCACTACTGCGCGCTGCTGCTGGCCGCGGCGCTGGCGGTGTGCGCCTTCTACTACCTGGGCTCAGGCCGGGAGACCTTCTCCAGCGCCAC

CAAGAGGCTGAAGGAGGCCCGCGCCGGGGCCGCCGCGCCCACGCCGCCCGCACCCGAGCTGGCCCGGGGCTCCGCGGCGCCGGCCTCCGGGGCCAAGGCC

AAGAGCCTGGAGGGCGGCGTGGTGGTCCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAACGCGCCGCTGCAGGCCAAGGCTCGGG

TGGCGCTGAGCTCCCTGCTGCGCCTCGCCAAATTCGAGGCGCACGAGGTGCTTAACCTCCACTTCGTGAGCGAAGAGGCCAGCCGCGAGGTGGCCAAGGC

CCTGCTGCGGGAGCTCCTGCCGCCCGCCGCCGGCTTCAAGTGCAAG GTCATCTTCCATGATGTTGCTGTGCTGACAGATAAGCTCTTCCCCGTCGTGGA

GGCCATGCAGAAGTACTTCAGTGCTGGCTCGGGGACCTACTACAGCGACTCCATCTTCTTCCTCTCGGTTGCCATGCACCAGATCATGCCCAAAG - UN

I10259 - AGATCCCGAGGATCATCCAGCTGGACCTTGACCTGAAGTATAAGACCAACATCCGAGAGCTGTTTGAGGAGTTCGACAACTTTCTGCCAGG

CGCTGTTATCGGCATAGCCAGAGAGATGCAGCCTGTGTACAG - UNI10821 - GCACACGTTCTGGCAGTTCCGCCATGAGAACCCCAAGACCAGAG

TTGGGGACCCTCCGCCTGAAGGACTCCCTGGCTTCAACAGTGGAGTGATGTTGCTGAACCTGGAGGCCATGCGCCAGTCTCCGCTCTACAGCCATCTGCT

GGAACCTTCGTGGGTACAGCAGCTTGCTGACAAGTACCACTTCCGGGGCCACCTGGGGGACCAGGACTTCTTCACCATGATTGGCATGGAGCACCCTGAA

CTCTTCCATGTGCTGGACTGCACCTGGAACCGGCAGCTGTGCACCTGGTGGAGGGACCATGGCTACAGCGATGTCTTCCAGGCATACTTCCGCTGTGAGG

GCCACGTCAAGATCTACCATGGGAACTGCAACACACCCATCCCAGAGGACTAGGCACCAGCTCACCCGCGATGCTGGTGGGGCTCCCGGGCCTGGGGAAG

AAAGAGAGACTCTGCTAGGACACTCTTTAGGGGTGAGGTGCTGCAGACCTCCCAGCTGGCTGGCTCCTATCCAGCCAATATCCAAAGAAGCTTAGCTGAG

CCTTGCTGCTGCTCGAGCTGTTTTCCTCCAGGGCAGCCCGAAGGACTGACACGGGTGTCTTCCAGGAGGTGGTCGAAGATACGGAAGGAAGGAGAATTGC

ACCCTTGTCCACACGGAATCAAAACCCTTGTAAAGAACTGGCTTTGCTAGACCAACTAAGCATTTCAAGCGGCAGGCTCTAATGCTTGGTGAGAGAAGAG

GTGGGTGCTACTGTGGCTCCCAGTGAGCACTGAATGCCTAGTCAGGGTTTTAACAAGCAGCCCAGGGCTTGAGCCTCCAAAGGAATGCCACAGTCCCACA

TCCTTTCCCAGGAGGCTTTGTACCTCCTCCAGATGTTCATGTTGCTTGGTGCTGGCTTCAAGAGCAGCACCTCATTAGATAAAGACTGAACACATAAAAA

AAACCCTTACTATAGTGTCCAGAGCTCTTATCCCTCCTCTATCCCAGAACCCCACCTTCTCTTGTCTGTCTACCTGCTCCAGGTGACCTGACTTCTACTA

AAGAATCAAACCCGTCATCCAAGGACAGAGGTTGGCCATGCCGGGGCATGCACTAGATTCACTCCAAGGAATTCACTCCAAGTCTAAAGTACTGGGTCAC

AAGTACAATTGGGGGGGCTTGGGAAAGGGTGGCCTCCTGCTCTCATTGTAGTCTCTGGAGAAGAAAGAAAACCAAACTCGTAATTGTCCACTGTGTCATG

CCAGCCCCTACCCCTTCCCAGAAGTGAGTACCATTTCTCTGTGTGCTTGAGACGGGCTTTGTGAGTCAGCTGCCCACATGAAGCCCCACAGGCCGTGTCT

GCACAGTCCAGCTCATGTCCTCAGGCAAGAAATGGGAGATTCTTATTGTATATAGTCAGTACCATGAGCGACAGACACTAGCTGATGAATAGACTTTGAG

AACTCTTGAGTCACGGTGTTTGTTCTCTGGCCAGTGTTCAGGGCTCTGGATGGGCAGTAGGATCAGCATCAAGCAGAAGGCCTAAGAGGCCCAACCGGCA

GGCCTGCACGTGGGCGCAGTGGGTGGTAGGTACTGCCCTGTTTGCTTCCAGGTGCAGAACTATCTCGTTCTAGCTCTTAGCAGGCTCATCCCCTGCCGGG

AACAAGCTCAGAAGTCTCTGGCTCCTTAGCCCAGACCTCCCAGTTCCATTCATGCTGGTGAGTGGCACACTCCTTCACTGGCCCTCTGCCGGGCCCAGTT

CCTCTGTTCTCCTTGCTACTTGATTTCCTATTCATAGTGTCTGGTTATTAGATGCCTGCGTGCGCCAGGCATCGTCTTCAGGATTTATATGTGCCCTAGA

TAATATTCATGAAAACCTCATCCAGTTCACTCCAGCTCTAAAACTGATGGATGAAAACAGAGACACGGACAGGTTCTCTGCTGTGCTGTTTACTGAAGCT

TTTTACTGTGCAAAAATGTTGGAAACAGCTTAAAATGTTGGCTAGAGAAGCAGATAAATAATGCATACTGCAACCGTATGGTGGAATATATCGCAAATCA

TTTGAAGGAATATTTAATGTACCAGGAAATGCTTATGCTAGTGAGTAAAGAATAC
Translation
MGLLRGGAACARAMARLGALRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAAAPTPPAPELARGSAAPASGAKAKSLEGGVVVPVDYHL

LMMFTKAEHNAPLQAKARVALSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKCK VIFHDVAVLTDKLFPVVEAMQKYFSAGSGTYY

SDSIFFLSVAMHQIMPKE - UNI10259 - EIPRIIQLDLDLKYKTNIRELFEEFDNFLPGAVIGIAREMQPVYR - UNI10821 - RHTFWQFRH

ENPKTRVGDPPPEGLPGFNSGVMLLNLEAMRQSPLYSHLLEPSWVQQLADKYHFRGHLGDQDFFTMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFQ

AYFRCEGHVKIYHGNCNTPIPED

For any suggestions or comments, please send an email to unitrap@crg.es