Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047459 (Dynlrb1)
Chromosomal location
Chr 2: 155062293 - 155076008 (+)
Description
dynein light chain roadblock-type 1 Gene [Source:MGI (curated);Acc:Dynlrb1-001]
RefSeq_dna
NM_025947 
RefSeq_peptide
NP_080223.1 
MGI
MGI:1914318 
Uniprot/SWISSPROT
P62627 
Uniprot/SPTREMBL
A2AVR8 A2AVR9 
Human Ortholog
ENSG00000125971 (DYNLRB1)
Omim not available
UniTrap UNI4895
Vector Insertion
Chr 2: 155062673 - 155068466
Public Clones AR0435 (sanger) 3SE306H07 (ggtc) (ggtc) 5SE306H07 (ggtc)
Private Clones OST67846 (lexicon) OST34783 (lexicon) OST23016 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6131
Vector Insertion
Chr 2: 155068543 - 155073506
Public Clones YHD360 (baygenomics)
Private Clones OST287841 (lexicon) OST287837 (lexicon) OST208011 (lexicon) OST205240 (lexicon)
OST190254 (lexicon) OST79773 (lexicon) OST67493 (lexicon) OST63775 (lexicon)
OST26838 (lexicon) OST8180 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109682
Sequence
AGAAGGGCGGGGAACGCGGCTAAGTGTTGGCGATTCGGAGCTGCAGGATCCGTCCGAGATG - UNI4895 - GCAGAGGTGGAGGAAACACTCAAGAG

GCTTCAGAGCCAGAAAGGAGTGCAGGGCATCATCGTGGTGAACACAGAAG - UNI6131 - GCATTCCCATCAAGAGCACAATGGACAATCCCACCAC

TACACAGTATGCCAACCTCATGCACAACTTCATCTTGAAGGCGCGGAGCACTGTGCGTGAGATTGACCCCCAAAACGACCTAACCTTCCTTCGAATTCGC

TCCAAGAAAAATGAAATTATGGTGGCACCAG ATAAAGACTATTTCCTGATTGTGATCCAGAATCCAACTGAATAAGCCACTGTCTGGGCTTCCTGTGTC

ATTCCTTAATTTAATGTCCCCCAAGAATAATAGTGCTAATCATGTCAGTGGGCACGTGGTGGCCACCTGAGCCTGTGTAGACCATGCCATTGATCAAGGG

TCGCTCTGCCCACCCCACAAGGAGTGCCTCTGATCCAGTCAGCCCCTGGGGAATCAGTTCGCCCTTGCAGGCTTTGGAATGAGAGCTTATGATAAGCCCA

CACCCAGCTCTTCAAACTTTCAGTTCACCTTGTCCCCCTTGGAAAGCTGTTTTTGTTTTTTAAAGTAAAAATTACTTCAACCCC
Translation
M - UNI4895 - AEVEETLKRLQSQKGVQGIIVVNTEG - UNI6131 - GIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRS

KKNEIMVAPD DKDYFLIVIQNPTE
Transcript ENSMUST00000054912
Sequence
ATGGCCTTTCCTCCTCCGCTCTGGGAA - UNI4895 - GCAGAGGTGGAGGAAACACTCAAGAGGCTTCAGAGCCAGAAAGGAGTGCAGGGCATCATC

GTGGTGAACACAGAAG - UNI6131 - GCATTCCCATCAAGAGCACAATGGACAATCCCACCACTACACAGTATGCCAACCTCATGCACAACTTCATC

TTGAAGGCGCGGAGCACTGTGCGTGAGATTGACCCCCAAAACGACCTAACCTTCCTTCGAATTCGCTCCAAGAAAAATGAAATTATGGTGGCACCAG AT

AAAGACTATTTCCTGATTGTGATCCAGAATCCAACTGAATAAGCCACTGTCTGGGCTTCCTGTGTCATTCCTTAATTTAATGTCCCCCAAGAATAATAGT

GCTAATCATGTCAGTGGGCACGTGGTGGCCACCTGAGCCTGTGTAGACCATGCCATTGATCAAGGGTCGCTCTGCCCACCCCACAAGGAGTGCCTCTGAT

CCAGTCAGCCCCTGGGGAATCAGTTCGCCCTTGCAGGCTTTGGAATGAGAGCTTATGATAAGCCCACACCCAGCTCTTCAAACTTTCAGTTCACCTTGTC

CCCCTTGGAAAGCTGTTTTTGTTTTTTAAAGTAAAAATTACTTCAACCCC
Translation
MAFPPPLWE - UNI4895 - AEVEETLKRLQSQKGVQGIIVVNTEG - UNI6131 - GIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQND

LTFLRIRSKKNEIMVAPD DKDYFLIVIQNPTE

For any suggestions or comments, please send an email to unitrap@crg.es