Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047583 (Tyw3)
Chromosomal location
Chr 3: 154240163 - 154260059 (-)
Description
tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Tyw3-001]
RefSeq_dna
NM_172474 
RefSeq_peptide
NP_766062.1 
UniGene
Mm.347513 
MGI
MGI:2445040 
Uniprot/SWISSPROT
Q8BSA9 
Uniprot/SPTREMBL
B2RUA6 
Human Ortholog
ENSG00000162623 (TYW3)
Omim not available
UniTrap UNI8108
Vector Insertion
Chr 3: 154257499 - 154259816
Public Clones RRG118 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052774
Sequence
ATGGCTGCGCCCATGGAGAAGAAGGCGCATTCCAGAGCAGAAAGCCGACCCCAGCTCGCTCGCTCGCTCATGGACCGTAGCGCGGAGTTCGGCCGGTGGA

AGGCGCAGAGTCTGAGCAAGGCGGACCTTAGCCGCAAGGGCAGTGTGGACGAGGACGCGGTGGAGGTGGTGGAGCTCCTGAACTCGCGGGAAGAGTTTTT

CACCACCAGCTCCTGCGCAGGGCGCATCCTCCTTCTGGACGGG - UNI8108 - AGCACAGAAGGCTCTGGAGTTCAGAAGCAACACTGCTGCTGGCT

GCTGGTCACACACAAACCGTGTGCGAGAGACGATGTG ATGGCAGCTCTGAAGGGTGCAACCAGCGAAGCTGTTTTGAAGTTTGAACCTTTTATCCTCCA

TGTGCAATGCCGGACACTGCAGGACGCACAAACCCTG CACTCAGTGGCAATTGATTCTGGCTTCAGGAACTCTGGCATCACCGTGGGAAAGCGAGGGAA

GACCATGCTG GCTGTCCGGGGTACACATGGATTGGAAGTCCCATTAACCCACAAGGGAAAGCTGATGGTGACAGAGGAATATATTGAGTTCCTGTTAAC

TATAGCAAATCAGAAAATGGAGGAAAACAAGAGAAGAATTGGGAG GTTTTATAACTACCTACAACATGCTCTCAAACGAGAAACCATTTCAAACTCACA

TTCCAAGATCAAAGAGAGAAATAACCCACTTTGTACTCATAAGAATAGGCGGAGCCAAGGAAAAGCGCAGGGCCCATCGACCACTGAAGACAACGGGAGG

GAGCTGGAAGACGGTGATGGCCTGGAAATCAGTGCTGCACTCTTCCTGGGAGACGACTGAGGCCTGGCACAGTGTCGTCTCTGGTGCACGGTATAAGGCT

GCTCTTTACAAGAGTATCAAGGCTTGCTGAGGGCATCAACCCTACAGGAGGCAAGAGTTAATTTCTCTGTTTTAGAGAAACTTAAGTGTAAATGGCTTTT

CAAAGTAGCTTTGTGTATGTTTGCTCTCTGAAGACTGCTTTTTAAGCACATTAGGAGTCACTCTACAAATAAACGTAAAGCTTCCTGTGTCTATTTATGT

CAAATAGGAAAAGCAAGGTTACTTCTTCTCTGAGGTGGCCTCAGCATCATGAGCATGCGAGTTGGAGCCATGGGAACAACCTCACTCCAACCCTGAGCCT

TTCTTACAGGGCAGCTCAGAATTTGCATTTCTTGCCCTGGACAAGTGTCTCCTCTTGCTTTGGCCGTGTGGATAAAAGTAACTGATATACACGTGAGTAT

TTTGTTCAGGGAAATACCTGTGCCTTCTGTCTACTTTGTCTCTCACCACCAGAGCTTGCTGCTAGCAGCCGCTGAGACACATGGGGGTAGCTTTTTCTAA

GCTTGCTTAGGAATGATCACCAAGACACAGACATCCGCATAAAACAGAACACATGTGCCATGACAGCTTGAAGGGTTAGGACTTGAGTTCTGACATCAGA

GGTCCTGTAGCAAACCATTTCATTTTGTGGGTTTCCATTTCTTCTAACACCTGCTGTGTTCGCACTTGAGGGATGACTGGATCAGATAGGAAGTGAGCAT

TGGCCAGCAATAGTCTATTGCAGCATTACCATTTTTCCTCATTGAAGGGAAGGTGACTTCATCGTTTTCAAATGTACCAGTCATGAAGATGGCATTGACA

GCATCAGGGAGCATCATGGGAGCAGAGGCCGTCTCTAGCTTTGGCAGCAGGAGCTTGAGGCAACTTGTCACATTGCATCCGTAGTCAGGGAGCCCAGGGG

ATGGTGCCGCCCACATCAGGATGGATCTTCTTGATTAAAACTCATAAAACAGACAGCAGAGGTATGTCTCCTGGGTGATTCCGAATCTCATCAAATCGAG

TAAATTAACTGTCACAAGTTCAACCTTTGTCAGTCAGATGTCCAGACACATTACTTCTTAAACTTTTATTAGGATGTATTTTATTAGCTCTGGTTATACA

TCTATGTGTTTGAGTGTGGATATGAACACATGTGAACAGTTGCCCATACAGGTCAGAAGTTTGAGAAGCCCTGGAGCAGACAAGTGTGATCTGCTTAGCA

CAAGCACATCTCCTGAGTCAGGCGATTTCAAATGCCGGCAAGCTGGAAAGGAAGGTTAACTGTAACTGTCATCTTTATTTTTCTTAAATCTGTAAGTAAA

GTCAGTCAAGTCGGCATTTTAGGAACCCTTCCTGACCGGCTTATTCCAGACAGCACGAGAAGAAGCCCCATGAGCGGAGGCTGGAGCAGACAAGTGTGAT

CTGCTTAGCACAAGCACATCTCCTGAGTCAGGTGATTTCAAATACTGGCAATTTCAAGTCGGCATTTTAGGAACCCTTCCTGACCGGCTTATTCCAGACA

GCACGAGAAGAAGCCCCATGAGCGGAGGCTGGAGCAGACAAGTGTGATCTGCTTAGCACAAGCACATCTCCTGAGTCAGGTGATTTCAAATACTGGCAAT

TTCAAGTCGGCATTTTAGGAACCCTTCCTGACCGGCTTATTCCAGACAGCACGAGAAGAAGCCCCATGAGCGGAGGCTGGAGCAGACAAGTGTGATCTGC

TTAGCACAAGCACATCTCCTGAGTCAGGTGATTTCAAATACTGGCAATTTCAAGTCGGCATTTTAGGAACCCTTCCTGACCGGCTTATTCCAGACAGCAC

GAGAAGAAGCCCCATGAGCGGAGGCTGGAGCACACCTGCCCTGTAGGTTTCTGTGGATTCCTTAGATGAGCAAGCACCTGTGATACTGTCTATGCTCAGG

ACAATGCTGTGTTTGCACTCTGGTGAAGGGCGTGGCAGGAAGCCCTGGTGCTGTGTGGCGTGTGCCTTGCACAACTTGCACTCTTGTAACTGCAGCTGCA

CGTTACGTATAAGCATATACAGCTTGCTGCCAGGTAGGGAACTGGGGTAGGGAAAGGAAACTTACAGTCTTAGAATGTCTTGAGCATGGCTTCTGAATTA

CTGAATAAAATCTAAATGATCTGCCAGGTAAGCAGTCAGAAGGAGTGACAACATGTAAACAGAACAGCCAGCATGGTGGTAGTGGTGGTGGTGGGGGGAC

CCTAGGTAGAACCACCACAGGGAAGGGACCTGAGCTGCAGTGACCACCCTGGGTTTTAGCCTCTGAACTAGAAGGCATTCTCTGCTTCTCCCTGGGGCAA

CCATTCACTGCCCAGGTTTGACTCCTCCAGGTTCCACAAGCTTTGTTTCTGGAGTTCTTGGACCAGACATCAACCAAGTTATGGCCAAGCAGATACGTTT

CATGTGGCTCACATGAGGGTGGTTTTCCTAATTGGGTCATGATTTTAAAGTACAATTAGCTCACAGTGGGAGTAAAACTGCATCTCTAGGGTTTGTTTTG

TTTGTTCCCTTTAATTGGAAAACTTGGGTTGTTGGAGGCACACATCCCACATGACACTCAGCCAGCCACATTCTGGCTGTAACATTTGAAAAGAGTCATC

CAGTTCCCCTCAGACCCTTCCCATTGCTAGCTCTCTGACAGACACCTCATTAGTTGGTCCCTATGGGTGTCAGTCTGTGGTGGCAAGCCCCGGATAAACA

CTGGAGAGAAACAAACCTGTTAACTGTATTAGTGTATCGTAGGACAAAAAGATAAACTGCTACAATTCCTACGGATGCAAGATCAAAATGCCAAGCCCTT

TGTATAACGATGTTTAGGAATTTGAAGATAGCTACCACC
Translation
MDRSAEFGRWKAQSLSKADLSRKGSVDEDAVEVVELLNSREEFFTTSSCAGRILLLDG - UNI8108 - STEGSGVQKQHCCWLLVTHKPCARDDV M

AALKGATSEAVLKFEPFILHVQCRTLQDAQTL HSVAIDSGFRNSGITVGKRGKTML AVRGTHGLEVPLTHKGKLMVTEEYIEFLLTIANQKMEENKRR

IGR RFYNYLQHALKRETISNSHSKIKERNNPLCTHKNRRSQGKAQGPSTTEDNGRELEDGDGLEISAALFLGDD

For any suggestions or comments, please send an email to unitrap@crg.es