Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047603 (Zfp235)
Chromosomal location
Chr 7: 24919182 - 24928258 (+)
Description
zinc finger protein 235 Gene [Source:MGI Symbol;Acc:MGI:1929117]
RefSeq_dna
NM_019941 
RefSeq_peptide
NP_064325.2 
UniGene
Mm.295595 
MGI
MGI:1929117 
Uniprot/SPTREMBL
Q3UGN8 Q499D5 Q9R161 
Human Ortholog
ENSG00000159917 (ZNF235)
Omim not available
UniTrap UNI25335
Vector Insertion
Chr 7: 24919507 - 24920276
Public Clones not available
Private Clones OST187430 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098695
Sequence
ACGGCTGAGGTGACTTCCGCTGCCGCAAGGCCAGGCTCCCTGGCAGTACTTCTGATGAGGTGACATCCTGCAGCGTTCCGCGACCCTTCTGTGTGCTGGT

GTTTCGGTGTGTCTTCTCGGGGACCGAGTCTGCATCTCCGGGGAGAAGAGGGGCACCGCTGGCGTCGGCCGGTCCTCTCTAGCTGGGCTCTGCTTGAGAC

GGCGCTGCCCAGGATTCCTGGACCCGTCTCAGCTGCTTGTGGAGCCCTGGAGAGAGTCTAGCTTCCCACGGGAGTCTGTCAGAGGAACGGTGATGGCAGA

TAGCAGTGTCCTAAAGCCTTAAGTG - UNI25335 - CTTGCTTCCCAGAGCCCTGCCTTGTCTCAAAGAGAAGAGAACAATGACCAAGTTACAG GA

GGCAGTGACGTTCAGGGATGTGGCCGTAGTCTTCAGTGAAGAGGAGATGGGGCTGCTGGACGCTGCCCAGAGGAAGCTGTACCATGATGTGATGCTGGAG

AACTTCCTGAACCTCCTGGCAGTGG GCTGGTTCCACTCCCTGTTAGCAGCTTTCCTCAGCAGGTATCCCACAGCTCTGGCACCTCTGACCTCTTGTGGT

CTCCAAGGCAATCCAGGCTTCACCTCCCAAGCTTCACACAGTACAGGGATAGTCCGCCCACACGCCTGGCCTCTGAGGCTTTCATTAGCTGCAGGGAATT

TCCACAGCCTCTTTCATGTGTCCTTGACTCAAACAG GAAGTCAGAGTCCAAACAAGGTGGACACTCTTGACTCAACAGGATTAAGGCACCTTTCACTGG

GGTGGCTTCCATGCTGGCATATGACAGGCCATGATGTCAAGAAACTGGCCAGCACTCCAGATGTTGTAGTAAACATTCAAGGAAAGAGTTCTCACTTCCT

GGAGCAATGTCACTCCTCCTGCCATGGCGGAACAGAAGAGCCTCTCCAGGTCTCCGAGGATAATGGCTGTCTGGAGAGTCTCACAAGCGATCATTCCAGC

ATTACCGAAAATCAGGAATTTCTGTCTGGGAGGGCTCAGAGTTCTTGGAGTAAAACAGACTTTAGTGAGAGATGGAACCATGAGAAACGCTGTACTCAGA

CTCTGGTGAAAACTAAGTCTCAGCTGTTGGCTCTGGGTGTTGACATTCTGAATTGCATTTCCCATCAAGATAACAATATACTGCATAAAAGAGACAAAGT

CCCCAGCAGTGGTGACTGTGATCAAGTCATCTTCCCTATGGCATGTCTCACCCAGTCTCCTGTTTACACAGAACAGAAGGCCTACCAGTGCAACACAGGC

CAAGACGCCTTCATTGACAGCCCCAGTCAGGAGACTCAGCAGGTCCTCTTAGGAAATAAGTCCCCTGTACATGGTACATATGAGGACACTAGTTATACCT

CCAGTGTCATTCAACAAAGTGTCCATCCAGGAAGAAAGCGCTACTGGTGTCAAGAGTGTGGCAAGGCTTTCAGTCAGAGCTCAAATCTGCAGACTCACCA

GAGAGTGCACACGGGGGAGAAACCCTATACCTGCCCTGAGTGTGGGAAGAGCTTTAACCAGAGCTCACACCTGTATGCTCACCTGCCCATCCACACAGGC

GAGAAGCCCTACTGCTGCGACAACTGTGGGAAGGGCTTCAGCCGAAGCACAGATCTCAACATTCACTGCCGAGTGCACACTGGAGAGAAACCTTACAAGT

GTGAGGTGTGTGGGAAGGGCTTCACACAGAGGTCACACCTCCAGGCCCATGAGAGAATTCACACAGGAGAGAAGCCATATAAGTGTGGAGACTGTGGCAA

ATGCTTCAGCTGTAGCTCAAACCTTCACACCCACCAGAGAGTCCACACTGAAGAGAAACCGTACAAGTGTGACGAGTGTGGGAAGCGCTTCAGCTTGAGC

TTCAACCTCCACAGCCATCAGCGGGTCCACACAGGAGAGAAGCCATATAAATGTGAAGAGTGTGGGAAGGGTTTCAGTTCAGCCTCAAGCTTCCAAAGCC

ACCAGAGGGTCCATACAGGAGAGAAGCCATTTTGCTGCAGTGTCTGTGGGAAGGGCTTCAGTCAGAGCTCCTATTTTCAAGCCCATCAGAGAGTTCACAC

TGGGGAAAAACCATACAGATGTGATGTGTGTGGGAAGCGCTTCAACTGGAGTTTGAACCTCCACAATCACCAGAGAGTCCACACTGGAGAGAGACCATAT

AAATGTGAGGAGTGTGGAAAAGGCTTCAGTCAGGCCTCCAATCTGCAGGCCCATCAGAGTGTCCACACTGGTGAGAAGCCATTCAGATGCAATGCGTGCC

AGAAGCGATTCAGTCAGGCCTCGCACCTCCAGGCCCATCAGAGAGTGCACACAGGGGAGAGGCCCTACAAATGTGACACATGTGGGAAAGCCTTCAGCCA

GAGATCCAATCTCCAAGTTCATCAGATAATTCACACCGGGGAGAAGCCGTTCAAGTGTGAGGAGTGTGGGAAGGAATTCAGCTGGAGTGCAGGACTTACT

GCTCACCAGAGGGTCCACACAGGAGAGAAACCCTACACGTGTCAGCAGTGTGGGAAGGGCTTCAGTCAGGCCTCACACTTCCACACTCACCAGAGGGTCC

ACACTGGGGAAAGGCCCTACATCTGCAGCATTTGCTCTAAGGGCTTCAGTCAGAGATCACATCTGGTCTACCACCAGAGAGTCCACAGTGCAGGGAATCC

CTAGGTTTGTTCTATTAGGTGGGCTCCACGCTGCTTTCCTCAAACCCAGAGGCTTCAGGAGACTTCACCGGGATTATCTCTTTTCTTTGGGAGATCTTTT

TTTTTTTTCTTTTTGTTTTTTATTTTATTTATTTTAATTTTTTTAAGACCAGATTTCTTTGGCTGTCATGGAACTTGCTCTGTAGACCTGGCTAGCCTTG

AACTCACAGAGATCCACCTGCTTTCGACTCCTGAGTGCTGGGATTAAAGGTGTGTGCCCAGCTGGGAGATCAGTTCTTTATAAATGTCAGAAATTACGTA

TAAGAAGATCATTGCTCTATAAATGTACTGTTACCATGTACAAGAGTTCTAAGGTTGCCACCCTCAGGATATGACGGAGCAGGAAATCTCAGCATCCATC

CAAGTCTCCAGAAAGGCTGCAGGAAGTGCTTTAACCACAGCTGGTGATTGGCAGAACCGCCGTTGACTGAAGCATCACTTCCTCATAGGAAGCTCCTCTC

TGTATCTGCTGTGCAGAGCTGCATGTGGCTCAGGACCCAGCCATTCCTGGAGCAAGTTAGAAAAGCCCCTGCAAGTAAGGCTCAAATTCGAAAACACTTG

TCAACCCTCAACCCTGCATTCATATTGAGTCGTATTCCCCAGTAATCGTGTAAGGGACCATTAGTCAGCTCCCTTGAGGCATAGTGCTACCCAGTCAAGG

CTGCAGTGTGTGACCTGCCTCTCTAGCATGGTGCTTTGCATGGCAATAGCAACTCTGTACTGGATGAGTTTTAGTATTTGTACTTAATAGACTAAAACCA

TGCTCTGTTTGAAAATTCCATATTTATCAACCCAATAAGGTGAACTGAAACTTATGCGATTGGAATTTTGGGCCCTGAATTCATTGAGGAAAGAGCTTTT

TATTGTAATCACTACTGCAAATGTTTTTGCAAAGTATTTGCTGATGACATAAAGGTTCTTAATAAACTTGAATTATT
Translation
 - UNI25335 - MTKLQ EAVTFRDVAVVFSEEEMGLLDAAQRKLYHDVMLENFLNLLAVG GWFHSLLAAFLSRYPTALAPLTSCGLQGNPGFTSQA

SHSTGIVRPHAWPLRLSLAAGNFHSLFHVSLTQTG GSQSPNKVDTLDSTGLRHLSLGWLPCWHMTGHDVKKLASTPDVVVNIQGKSSHFLEQCHSSCHG

GTEEPLQVSEDNGCLESLTSDHSSITENQEFLSGRAQSSWSKTDFSERWNHEKRCTQTLVKTKSQLLALGVDILNCISHQDNNILHKRDKVPSSGDCDQV

IFPMACLTQSPVYTEQKAYQCNTGQDAFIDSPSQETQQVLLGNKSPVHGTY
Transcript ENSMUST00000056549
Sequence
ACGGCTGAGGTGACTTCCGCTGCCGCAAGGCCAGGCTCCCTGGCAGTACTTCTGATGAGGTGACATCCTGCAGCGTTCCGCGACCCTTCTGTGTGCTGGT

GTTTCGGTGTGTCTTCTCGGGGACCGAGTCTGCATCTCCGGGGAGAAGAGGGGCACCGCTGGCGTCGGCCGGTCCTCTCTAGCTGGGCTCTGCTTGAGAC

GGCGCTGCCCAGGATTCCTGGACCCGTCTCAGCTGCTTGTGGAGCCCTGGAGAGAGTCTAGCTTCCCACGGGAGTCTGTCAGAGGAACGGTGATGGCAGA

TAGCAGTGTCCTAAAGCCTTAAGTG - UNI25335 - CTTGCTTCCCAGAGCCCTGCCTTGTCTCAAAGAGAAGAGAACAATGACCAAGTTACAG GA

GGCAGTGACGTTCAGGGATGTGGCCGTAGTCTTCAGTGAAGAGGAGATGGGGCTGCTGGACGCTGCCCAGAGGAAGCTGTACCATGATGTGATGCTGGAG

AACTTCCTGAACCTCCTGGCAGTGG GAAGTCAGAGTCCAAACAAGGTGGACACTCTTGACTCAACAGGATTAAGGCACCTTTCACTGGGGTGGCTTCCA

TGCTGGCATATGACAGGCCATGATGTCAAGAAACTGGCCAGCACTCCAGATGTTGTAGTAAACATTCAAGGAAAGAGTTCTCACTTCCTGGAGCAATGTC

ACTCCTCCTGCCATGGCGGAACAGAAGAGCCTCTCCAGGTCTCCGAGGATAATGGCTGTCTGGAGAGTCTCACAAGCGATCATTCCAGCATTACCGAAAA

TCAGGAATTTCTGTCTGGGAGGGCTCAGAGTTCTTGGAGTAAAACAGACTTTAGTGAGAGATGGAACCATGAGAAACGCTGTACTCAGACTCTGGTGAAA

ACTAAGTCTCAGCTGTTGGCTCTGGGTGTTGACATTCTGAATTGCATTTCCCATCAAGATAACAATATACTGCATAAAAGAGACAAAGTCCCCAGCAGTG

GTGACTGTGATCAAGTCATCTTCCCTATGGCATGTCTCACCCAGTCTCCTGTTTACACAGAACAGAAGGCCTACCAGTGCAACACAGGCCAAGACGCCTT

CATTGACAGCCCCAGTCAGGAGACTCAGCAGGTCCTCTTAGGAAATAAGTCCCCTGTACATGGTACATATGAGGACACTAGTTATACCTCCAGTGTCATT

CAACAAAGTGTCCATCCAGGAAGAAAGCGCTACTGGTGTCAAGAGTGTGGCAAGGCTTTCAGTCAGAGCTCAAATCTGCAGACTCACCAGAGAGTGCACA

CGGGGGAGAAACCCTATACCTGCCCTGAGTGTGGGAAGAGCTTTAACCAGAGCTCACACCTGTATGCTCACCTGCCCATCCACACAGGCGAGAAGCCCTA

CTGCTGCGACAACTGTGGGAAGGGCTTCAGCCGAAGCACAGATCTCAACATTCACTGCCGAGTGCACACTGGAGAGAAACCTTACAAGTGTGAGGTGTGT

GGGAAGGGCTTCACACAGAGGTCACACCTCCAGGCCCATGAGAGAATTCACACAGGAGAGAAGCCATATAAGTGTGGAGACTGTGGCAAATGCTTCAGCT

GTAGCTCAAACCTTCACACCCACCAGAGAGTCCACACTGAAGAGAAACCGTACAAGTGTGACGAGTGTGGGAAGCGCTTCAGCTTGAGCTTCAACCTCCA

CAGCCATCAGCGGGTCCACACAGGAGAGAAGCCATATAAATGTGAAGAGTGTGGGAAGGGTTTCAGTTCAGCCTCAAGCTTCCAAAGCCACCAGAGGGTC

CATACAGGAGAGAAGCCATTTTGCTGCAGTGTCTGTGGGAAGGGCTTCAGTCAGAGCTCCTATTTTCAAGCCCATCAGAGAGTTCACACTGGGGAAAAAC

CATACAGATGTGATGTGTGTGGGAAGCGCTTCAACTGGAGTTTGAACCTCCACAATCACCAGAGAGTCCACACTGGAGAGAGACCATATAAATGTGAGGA

GTGTGGAAAAGGCTTCAGTCAGGCCTCCAATCTGCAGGCCCATCAGAGTGTCCACACTGGTGAGAAGCCATTCAGATGCAATGCGTGCCAGAAGCGATTC

AGTCAGGCCTCGCACCTCCAGGCCCATCAGAGAGTGCACACAGGGGAGAGGCCCTACAAATGTGACACATGTGGGAAAGCCTTCAGCCAGAGATCCAATC

TCCAAGTTCATCAGATAATTCACACCGGGGAGAAGCCGTTCAAGTGTGAGGAGTGTGGGAAGGAATTCAGCTGGAGTGCAGGACTTACTGCTCACCAGAG

GGTCCACACAGGAGAGAAACCCTACACGTGTCAGCAGTGTGGGAAGGGCTTCAGTCAGGCCTCACACTTCCACACTCACCAGAGGGTCCACACTGGGGAA

AGGCCCTACATCTGCAGCATTTGCTCTAAGGGCTTCAGTCAGAGATCACATCTGGTCTACCACCAGAGAGTCCACAGTGCAGGGAATCCCTAGGTTTGTT

CTATTAGGTGGGCTCCACGCTGCTTTCCTCAAACCCAGAGGCTTCAGGAGACTTCACCGGGATTATCTCTTTTCTTTGGGAGATCTTTTTTTTTTTTCTT

TTTGTTTTTTATTTTATTTATTTTAATTTTTTTAAGACCAGATTTCTTTGGCTGTCATGGAACTTGCTCTGTAGACCTGGCTAGCCTTGAACTCACAGAG

ATCCACCTGCTTTCGACTCCTGAGTGCTGGGATTAAAGGTGTGTGCCCAGCTGGGAGATCAGTTCTTTATAAATGTCAGAAATTACGTATAAGAAGATCA

TTGCTCTATAAATGTACTGTTACCATGTACAAGAGTTCTAAGGTTGCCACCCTCAGGATATGACGGAGCAGGAAATCTCAGCATCCATCCAAGTCTCCAG

AAAGGCTGCAGGAAGTGCTTTAACCACAGCTGGTGATTGGCAGAACCGCCGTTGACTGAAGCATCACTTCCTCATAGGAAGCTCCTCTCTGTATCTGCTG

TGCAGAGCTGCATGTGGCTCAGGACCCAGCCATTCCTGGAGCAAGTTAGAAAAGCCCCTGCAAGTAAGGCTCAAATTCGAAAACACTTGTCAACCCTCAA

CCCTGCATTCATATTGAGTCGTATTCCCCAGTAATCGTGTAAGGGACCATTAGTCAGCTCCCTTGAGGCATAGTGCTACCCAGTCAAGGCTGCAGTGTGT

GACCTGCCTCTCTAGCATGGTGCTTTGCATGGCAATAGCAACTCTGTACTGGATGAGTTTTAGTATTTGTACTTAATAGACTAAAACCATGCTCTGTTTG

AAAATTCCATATTTATCAACCCAATAAGGTGAACTGAAACTTATGCGATTGGAATTTTGGGCCCTGAATTCATTGAGGAAAGAGCTTTTTATTGTAATCA

CTACTGCAAATGTTTTTGCAAAGTATTTGCTGATGACATAAAGGTTCTTAATAAACTTGAATTATT
Translation
 - UNI25335 - MTKLQ EAVTFRDVAVVFSEEEMGLLDAAQRKLYHDVMLENFLNLLAVG GSQSPNKVDTLDSTGLRHLSLGWLPCWHMTGHDVKK

LASTPDVVVNIQGKSSHFLEQCHSSCHGGTEEPLQVSEDNGCLESLTSDHSSITENQEFLSGRAQSSWSKTDFSERWNHEKRCTQTLVKTKSQLLALGVD

ILNCISHQDNNILHKRDKVPSSGDCDQVIFPMACLTQSPVYTEQKAYQCNTGQDAFIDSPSQETQQVLLGNKSPVHGTYEDTSYTSSVIQQSVHPGRKRY

WCQECGKAFSQSSNLQTHQRVHTGEKPYTCPECGKSFNQSSHLYAHLPIHTGEKPYCCDNCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQ

AHERIHTGEKPYKCGDCGKCFSCSSNLHTHQRVHTEEKPYKCDECGKRFSLSFNLHSHQRVHTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFCCSV

CGKGFSQSSYFQAHQRVHTGEKPYRCDVCGKRFNWSLNLHNHQRVHTGERPYKCEECGKGFSQASNLQAHQSVHTGEKPFRCNACQKRFSQASHLQAHQR

VHTGERPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEECGKEFSWSAGLTAHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICSICSKG

FSQRSHLVYHQRVHSAGNP

For any suggestions or comments, please send an email to unitrap@crg.es