Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047675 (Rps8)
Chromosomal location
Chr 4: 116826441 - 116828737 (-)
Description
ribosomal protein S8 Gene [Source:MGI (curated);Acc:Rps8-001]
RefSeq_dna
NM_009098 
RefSeq_peptide
NP_033124.1 
UniGene
Mm.315904 Mm.336390 Mm.390262 Mm.398372 Mm.425154 Mm.441394 Mm.467468 Mm.470297 
MGI
MGI:98166 
Uniprot/SWISSPROT
P62242 
Uniprot/SPTREMBL
Q3UA25 Q3UJU6 Q497E9 Q5M9L9 Q9CQW4 Q9CRJ5 
Human Ortholog
not available
Omim not available
UniTrap UNI17972
Vector Insertion
Chr 4: 116828283 - 116828662
Public Clones CMHD-GT_472F1-3 (cmhd)
Private Clones OST432647 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3150
Vector Insertion
Chr 4: 116827713 - 116828175
Public Clones XT0328 (sanger) AW0198 (sanger) XR0650 (sanger) FHCRC-GT-S17-9C2 (fhcrc)
PST1293 (escells)
Private Clones OST305276 (lexicon) OST261696 (lexicon) OST37954 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14292
Vector Insertion
Chr 4: 116827242 - 116827713
Public Clones FHCRC-GT-S20-8B1 (fhcrc) PST1200 (escells) PST14258-NL (escells) PST14182-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15527
Vector Insertion
Chr 4: 116826903 - 116827419
Public Clones PST17323-NR (escells) PST7123-NR (escells)
Private Clones OST261458 (lexicon) OST33210 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14963
Vector Insertion
Chr 4: 116826440 - 116827034
Public Clones PST14752-NL (escells)
Private Clones OST85717 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061609
Sequence
GAAGGCGGGGCTGAGTTTTAGAAACCGGACCGTGAAGCTTTGCGCTTCCTCTTTCCAGCCAGCGCCGAGCGATGG - UNI17972 - GCATCTCTCGG

GACAACTGGCACAAGCGCCGCAAGACCGGGGGTAAGCGAAAACCCTACCACAAGAAGCGAAAGTATGAGCTGGGACGGCCCGCTGCCAACACGAAG - U

NI3150 - - UNI14292 - ATTGGCCCTCGCCGCATACACACAGTCCGAGTTCGAGGAGGCAATAAGAAGTACCGTGCCCTGAGATTGGATGTGGGG

AACTTTTCCTGGGGCTCTGAGT - UNI14292 - - UNI15527 - GTTGTACTCGCAAAACAAGGATCATTGATGTTGTCTACAATGCATCCAACA

ACGAGCTTGTCCGCACCAAGACCCTGGTGAAGAACTGCATCGTGCTTATTGACAGCACGCCGTACCGACAGTGGTACGAGTCCCACTATGCACTGCCCCT

GGGCCGCAAGAAGGGGGCCAAGCTG - UNI14292 - - UNI14963 - - UNI15527 - ACTCCTGAGGAGGAAGAGATTTTAAACAAAAAACG

ATCAAAGAAAATTCAAAAGAAATACGATGAAAGGAAAAAGAATGCCAAAATCAGCAGCCTCCTGGAGGAGCAGTTCCAGCAGGGCAAGCTTCTAG - UN

I14963 - - UNI15527 - CCTGTATTGCCTCACGACCAGGCCAGTGTGGCAGAGCAGACGGCTATGTGCTCGAAGGCAAGGAGCTGGAGTTCTATC

TGCGGAAGATCAAAGCCCGGAAAGGCAAATGAGCCTCATGTGTAGTGTAATAAAGGTGTCTGCTGTTCTATCTG
Translation
SFALPLSSQRRAMG - UNI17972 - GISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTK - UNI3150 - - UNI14292 - IGPRRIHTVR

VRGGNKKYRALRLDVGNFSWGSEC - UNI14292 - - UNI15527 - CCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYAL

PLGRKKGAKL - UNI14292 - - UNI14963 - - UNI15527 - TPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLA - UNI

14963 - - UNI15527 - ACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Transcript ENSMUST00000102696
Sequence
CTCTTTCCAGCCAGCGCCGAGCGATGG - UNI17972 - GCATCTCTCGGGACAACTGGCACAAGCGCCGCAAGACCGGGGGTAAGCGAAAACCCTAC

CACAAGAAGCGAAAGTATGAGCTGGGACGGCCCGCTGCCAACACGAAG - UNI3150 - - UNI14292 - ATTGGCCCTCGCCGCATACACACAGT

CCGAGTTCGAGGAGGCAATAAGAAGTACCGTGCCCTGAGATTGGATGTGGGGAACTTTTCCTGGGGCTCTGAGT - UNI14292 - - UNI15527 -

 GTTGTACTCGCAAAACAAGGATCATTGATGTTGTCTACAATGCATCCAACAACGAGCTTGTCCGCACCAAGACCCTGGTGAAGAACTGCATCGTGCTTA

TTGACAGCACGCCGTACCGACAGTGGTACGAGTCCCACTATGCACTGCCCCTGGGCCGCAAGAAGGGGGCCAAGCTG - UNI14292 - - UNI1496

3 - - UNI15527 - ACTCCTGAGGAGGAAGAGATTTTAAACAAAAAACGATCAAAGAAAATTCAAAAGAAATACGATGAAAGGAAAAAGAATGCCAA

AATCAGCAGCCTCCTGGAGGAGCAGTTCCAGCAGGGCAAGCTTCTAG - UNI14963 - - UNI15527 - CCTGTATTGCCTCACGACCAGGCCAG

TGTGGCAGAGCAGACGGCTATGTGCTCGAAGGCAAGGAGCTGGAGTTCTATCTGCGGAAGATCAAAGCCCGGAAAGGCAAATGAGCCTCATGTGTAGTGT

AATAAAGGTGTCTGCTGTTCTATCTG
Translation
MG - UNI17972 - GISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTK - UNI3150 - - UNI14292 - IGPRRIHTVRVRGGNKKYRALR

LDVGNFSWGSEC - UNI14292 - - UNI15527 - CCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKL -

 UNI14292 - - UNI14963 - - UNI15527 - TPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLA - UNI14963 - - UN

I15527 - ACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK

For any suggestions or comments, please send an email to unitrap@crg.es