Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047678 (Gpr82)
Chromosomal location
Chr X: 13238489 - 13244559 (+)
Description
G protein-coupled receptor 82 Gene [Source:MGI (curated);Acc:Gpr82-001]
RefSeq_dna
NM_175669 
RefSeq_peptide
NP_783600.1 
UniGene
Mm.383294 
MGI
MGI:2441734 
Uniprot/SWISSPROT
Q8BZR0 
Human Ortholog
ENSG00000171657 (GPR82)
Omim not available
UniTrap UNI30913
Vector Insertion
Chr X: 13239545 - 13242142
Public Clones IST12628B6 (tigm) IST14212A6 (tigm) IST14998H11 (tigm) IST10198H3 (tigm)
IST14489F12 (tigm) IST10860F1 (tigm) IST13079D2 (tigm) IST14434E2 (tigm)
IST11343C2 (tigm) IST11001B3 (tigm) IST14312C10 (tigm) IST13149F3 (tigm)
IST13149E1 (tigm) IST12551D4 (tigm) IST11360E10 (tigm) IST10218D11 (tigm)
IST10879B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053659
Sequence
GCTGATGGTTGCCCTCTCCAGCTTCTCAGGATCAATCTTTGAGTAAGCCCAACTTCTCATCATCTACGTACTAGACGAGTG ACTCTACTCATACTGATT

AAGGATACTGGAAGAGTGAAGATCAGAGAACTGTGAGTGTGAAACAGTCAATGAGCATAAGCTACTCAGACAG - UNI30913 - ACGAAGGACTTAT

CCATCGCTTTAAGTACTGTTGCTTTTACTTTAAGCAGACCACTGTGACAACGAGAAAAG CTCCTGTGACAAAAATCAAGAAAATCTAATATAAATGACT

AATAACTCGACATGCATTCAACCATCCGTGATTTCTACCACAGCTTTACCGGTCACTTACATCTTTTTGTTTATTATTGGTCTCTTTGGAAACTCACTTG

CTCAGTGGGTATTTTTAACAAAAATAGGTAAGAAAACATCAACACATATCTACTTGGCAAATCTTGTGACTGCAAACTTACTTGTGTGCACTGCTATGCC

TTTCATGGGTATATATTTCTTGAGAGGTTTTTATTGGAAATATCAATCTGTACAATGCAGACTGGTCAATTTTTTGGGAACTCTTTCTATGCATGTAAGT

ATGTTTGTCAGCCTCTTAATTTTAAGCTGGATTGCCATAAGCCGCTATGCTACCTTAATGAAAAAGGAGTCCAAGCAAGAGGCCACCTCATGCTACGAGA

GAATGTTTTATGGTCACGTACTGAAAAGATTTCGCCAGCCCAACTTTGCCAGAACAATGTGTATTTACATATGGGGAGTTGTGCTTGTCATAATTATTCC

AGTTACCCTATACTACTCAGTAGTCGAGGCTACAGAAGAAGGACAGAGCCAGTGCTACAATCGGCAGATGGAACTGGGAGCCAGACCTTCTCAGATTGCG

GGTCTCATTGGAACCACATTTATTGGATTCTCCTTTTTAGTAGTAGTGACATCATACTATTCTCTTGTCAGCCATCTGCGAAGAGTAAGGACCTGTACCT

CCATTACCGAGAAAGATTTGACCTACAGATCTGTGAAAAGACACCTTTTGATCATCCAGGTCCTCCTAGTAGTTTGCTTTCTTCCATATAGTATTTTTAA

ACCCATTTTTTATGTTCTGCACCAGAGAGAAGGAGACTGTCAGCAGCTGAATTATTTAATAGAAGCAAAAAACATCCTCACTTGTCTTGCATCAGCCAGA

AGTAGTACAGACCCCATTATATTTCTTTTATTAGATAAAACATTCAAGAAGACACTATATGGTCTCCTTACAAAATCTTAATTCACTGCACATTCTAACA

TATGGTTGACTTTTGGATAGAAAACACCACAAAATAGGAAAAAAAATGCATGTGACTCTTAGTGACATTAACGGGCACCAAGAAAACCTCTATGGTTTTT

TTAAAAAAAGATATATGCATAAAATTGGACTTACAGTTCTACTTATATTGAAAGACCAGATGGCAGAGACTTTCAGAGACAAGTCAAGCATACCAAAGGG

ATTCTACTGTGTGTGAAGTCAGACTTTTTGTTTTGTTTTGTTTTGTTTTCAGTCAGTTGTGGATATTCTGTTCAAAACACAATATTTTATGACTATAGGA

TGAAGAACCAAAAAGGCTTATGGGTTTGCCTGCTTTCTAACCTAATGCAAGTACCCATCTATGGTCAGATTTTATATTGTTGGTAACTTTAAAAAATAAT

TTTAAAATGTAAGTACTGGAAAAGTCGAGCAGTAAGAAATGTTTTTATTTAAATCCCATCTAACTGCATGAATAATGCAGTGTGAAGTCAATTTGGTATT

ATTTGGCTCATTTTACTGGGAAAGGCAATATTCAATGATTCTAATATTTAATACATAGATTTTACTTACACACATTTGGATTACACTTGTCAAAATAAAA

AAATATAAAATTATATGTCCATCTATATGCTATTTTATATATTTCCAATATAAATAATGGTGCTATCAATGATAGTACCTGCCATCTATTTAATTAATTT

TTGTAAACTAAACAAATGAAGTATAAAGAATTGTAACCATGTTGGATAAAAGGCTGGCCTCTGGATTCAAACTGTCTGGGTATTATACTGTCTCCATCTC

TTATTTAGATGGAGAATTTTGGGCAAACTACTTACTCTCTTTACATAATAGTTTCTTTAATCGTGGAACAGAAAATATGACCTGATTCATATCACTATTA

TTAAATCAGATACTGTTCCTACTGTGAGCTACCAGCACTTGCTATGTGCTAGGCCCTCTGTGTATATGTTTCATGATTATAATTTTAATCATCACAACCA

CAAAGCATGTTAATGTACTTACTGATGAAAAAACCCAGATATGAAGTGAAGTGGTTATCCCAATTCCTCCAGTATTTAAGTATATTTAAGAAGCAATCAT

TTCTTAGTGATAATTTCTTTCATGTAATCTTGCCAGTAACGAAAAGAGTGATTATATTCTGTATTGTATACATTATGATTAAAAAATAAAAAAAGTGTTC

TTCAAATGATCAT
Translation
  - UNI30913 -  MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIGKKTSTHIYLANLVTANLLVCTAMPFMGIYFLRGFYWKYQ

SVQCRLVNFLGTLSMHVSMFVSLLILSWIAISRYATLMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYYSVVEATEEGQ

SQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYYSLVSHLRRVRTCTSITEKDLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGDCQQ

LNYLIEAKNILTCLASARSSTDPIIFLLLDKTFKKTLYGLLTKS

For any suggestions or comments, please send an email to unitrap@crg.es