Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047730 (AC158220.4-201)
Chromosomal location
Chr 7: 28887802 - 28905877 (+)
Description
Fc fragment of IgG binding protein  [Source:RefSeq peptide;Acc:NP_001116075]
RefSeq_peptide
NP_001116075.1 
UniGene
Mm.292276 
Uniprot/SPTREMBL
Q497G7 Q58E52 Q6IS34 Q7TNG6 Q8K0P6 Q8R0K8 Q8R1G8 Q8R1H9 Q8R1J5 
Human Ortholog
ENSG00000090920 (FCGBP)
Omim not available
UniTrap UNI28638
Vector Insertion
Chr 7: 28902604 - 28905338
Public Clones not available
Private Clones OST24748 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000076648
Sequence
GTAGATGTCACGCTGCCCAGCAGCTACCATGGTGCAGTGTGTGGGCTCTGTGGAAACATGGACAAAAACCATCAAAATGACCAAGTCTTCCCTAATGGCA

CAATGGCACCCTCAATACCTACCTGGGGTGGCAGCTGGCAAGTTCCAGGGTGGGACCCTCTTTGTTGGCATGAATGTCAAGGGTCCTGTCCCACATGCCC

AGAGGACCGAGTGGAGGAGTATGAGGGTCCTGGCTTCTGTGGACCTCTGGCTCCTGGTACAGGGAGTCCTTTCACCAGCTGCCATGCCCATGTGCCTCCT

GAAAGCTTCTTCAAGGGCTGTGTGCTGGACGTCTGCCTGGGTGGGGGCAGCAAAGACATACTGTGCCAGGCACTGGCTGCCTATGCTGCTGCCTGTCAAG

CTGCTGGCATCAAAATCGAGGACTGGAGGACTCAGGCCGGTTGTG AGATCACCTGCCCTGACAACAGCCACTATGAGCTCTGTGGCCCACCCTGCCCAG

CCAGCTGCCCACCCCCTGCACGACACACAGCCCCAACTGTATGTGACGGGCCCTGTGTGGAGGGATGCCAGTGTGACGAGGGCTTCGTCCTGAGTGCTGA

TCAGTGTGTTCCCCTGGATGGTGGCTGTGGCTGCTGGGTCAATGGCACATACTATGAAGCAGGCACCGAGTTTTGGGCTGATACCACCTGCTCTAAGAGG

TGTCATTGTGGACCTGGAGGTGACTCCTTGGTCTGCAAGCCTGCCAGCTGTGGGCTGGGTGAGGAGTGTGCCTTGTTGCCCTCTGGAGAGATCGGCTGCC

AACCTACAAGCATAACTGAATGCCAAGCCTGGGGTGATCCCCATTACACCACCCTAGATGGGCACCGGTTTGACTTCCAAGGCACCTGCGAGTACCTGCT

GAGTGCACCCTGCCATGAGCCACCCACAGGGACTGAATACTTCAATGTCACCGTGGCTAATGAGCACAGGGGCAGCCAGGCTGTCAGCTACACACGAAGT

GTCACTCTGCAGATCTATGGCCTCAGCTTGACCCTCAGTGCCCAATGGCCCAGGAAGCTACAG GTGAACGGAGAGTTCGTGGCTCTGCCCTTCCATCTG

GACCAGAAACTCAGTGTTTACATAAGTGGAGCAGATGTAGTAGTGAACACTGCTTCGGGGGTCTCCCTGGCTTTTGACGGAGACAGTTTCGTGCGCCTGC

GCGTGCCCGCTGCCTATGCTGGCACCCTCTGTGGCCTGTGCGGCAACTACAACAAGAATCCCAACGATGACCTGACTGCAGTGGGCGGGAAACCTGAGGG

CTGGAAAGTGGGCGGAGCTCCAGGCTGTGACCAATGCGAGCCTGAGCCTTGCCCAAAACCCTGCACACCTGAGGAACAAGAACCCTTCCGCGGTCCCGAC

GCCTGCGGCATTATCACGGCCCCCGAAGGCCCACTAGCGCCCTGCCACAGCCTTGTGCCACCCACGCAGTACTTCGAGGCTTGCTTGCTGGACGCCTGTC

AGGTTCAGGGACATCCAGGTGGCCTCTGTCCTGCTATAGCCACCTATGTGGCAGCATGTCAAGCTGCTGGGGCCCAACTTGGAGAATGGAGAAAGCCAGA

CTTCTGTC CCCTCCAGTGCCCTGCCCACAGCCACTACCAGCTCTGTGGTGACTCCTGCCCTGTGAGTTGCCCGAGCCTCTCCGCCCCTGTGGGCTGTGA

AACCATCTGCCGTGAGGGCTGTGTCTGTGATGCTGGCTTCGTGCTCAGTGGTGACACCTGTGTCCCTGTGGGCCAGTGTGGCTGCCTCTACCAAGGGCGC

TACTATGTGTTAGGTGCCACCTTCTACCCAGGCCCTGAGTGTGAGCGGCTCTGTGAGTGCGGGCCTGATGGCCAGGTCACCTGCCAGGAAGGGGCAGACT

GTGAGCCCTATGAGGAGTGCCGGATAGAGAATGGCGTTCAGGCCTGTCATCCCACTGGCTGTGGCCACTGTCTGGCCAACGGAGGCCTCCATTATGTCAC

TCTTGATGGACGGGTGTATGATCTTCATGGCTCCTGCTCCTATGTCCTGGCCAGCGTCTGTCACCCAAAACCTGGAGATGAGGAGTTCTCCATTGTGCTC

GAAAAGAACTCAGCTGGAGATCCCCAGCGTGTGGTGGTGACCGTGGCAGGCCAGGTTGTGGGCCTGGCTCGAGGGCCACAG GTGACTGTGGATGGTGAA

GTCGTGACCCTGCCTGTGGCCACAGGCCACGTGAGTGTGACAGCCGAAGGCAGAAACATAGTTCTGCAGACAAACAAGGGAATGAAGGTTCTCTTCGATG

GCGATGCCCACATCCTCATGTCCATCCCGAGTTCCTTCCGTGGACGTCTCTGTGGCCTCTGTGGGAATTTCAATGGGAACTGGAGTGACGACTTTGTGCT

GCCTAGTGGAGCAGTGGCCCCCAACGTGGAGGCCTTTGGAACCGCATGGCGAGCTCCCGGCTCCTCCTTGGGCTGTGGTGAAGGCTGCGGGCCCCAAGGC

TGCCCAGTGTGCTTGGCAGAGGAGACACAAGCATATGAGAAAAATGATGCCTGTGGGAAGATCCGGGACCCCCACGGCCCCTTTGCAGCTTGCCACAAGG

TTCTGAGCCCCTTGGAATACTTCCGCCAATGTGTGTATGACATGTGTGCCCATAAGGGTGACAAAGCCTATCTCTGCCGTAGCCTGGCTGCTTATACTGC

AGCCTGTCAGGCAGCTGGGGCAGCAGTGAAGCCCTGGAGGACAGACAGCGTCTGCC CTCTCCAGTGTCCTGCCCACAGCCACTACTCCATCTGCACCCG

CTCCTGCCAGGGCTCCTGTGCTGCTCTCTCTGGCCTCACTGGCTGCACCACCCGCTGCTTTGAAGGGTGTGAGTGCGATGACCACTTCCTGCTCTCCCAC

GGTGTGTGCATTCCTGCCCAGGACTGCGGCTGTGTCCATAACGGCCAATATATGCCG GTGAACTCTTCCCTGATGTCCTCAGACTGCAGCGAGCGCTGT

TTCTGCTCCCCAAACAACGGTCTGACATGCCATGAAGCTGGCTGCCCATCTGGCCATGTCTGTGAGATCCAGGCTGGAGTCCGAGAGTGCCAGGCTGCCC

GTGGCCTCTGCTCCATCTCTGTTGGAGCCAACCTAACTACCTTTGATGGAGCTCACAATGCCATCAGCTCCCCTGGTGTCTATGAGCTTTCTTCTCGATG

CCCGGGACTCCAAAAGAATGTGCCCTGGTACCGAGTGCTTGCTGATGTCCAGCCTTGCCACAACAATGACAAGATCGTGAGCAAGGTCCACATCTTCTTC

CAGGATGGCCTGGTGACTGTGATCCCAAGCAAGGGTGCATGG - UNI28638 - GTGAATGGTCTCCGCGTGGATCTCCCAGCTACTGTGTTAACATC

TGTGTCTGTGAGGAGGATGCCCGACGGCTCCATGCTTGTCCACCAGAAGGCTGGGGTCACGGTGTGGCTTGGAAAAGATGGGCTTCTGGATGTGATGGTT

GGTGATGACCTTGCAGCCATGCTGTGTGGGGCCTGTGGAAACTTTGATGGGGACCAAACCAACGACGCATATGGTTCTCAGGGGAAGACACCGATAGAGA

AGTGGAGAGCACAGGACTTCTCCCCATG TTCCAACTGATCAGTCACCACTGGCACTGAAGGCATCAAGACCTGCTCCCTCCCAGAAGTTACAGTGATTG

GAAGATGCCCTGTGTGTCCCTTCCCTGTCCCTCCCCCTTTGCTGAGCCACTGAGGCCAAACCTGAAAGCATTGAGTAAATAAATACCTAGAC
Translation
VDVTLPSSYHGAVCGLCGNMDKNHQNDQVFPNGTMAPSIPTWGGSWQVPGWDPLCWHECQGSCPTCPEDRVEEYEGPGFCGPLAPGTGSPFTSCHAHVPP

ESFFKGCVLDVCLGGGSKDILCQALAAYAAACQAAGIKIEDWRTQAGCE EITCPDNSHYELCGPPCPASCPPPARHTAPTVCDGPCVEGCQCDEGFVLS

ADQCVPLDGGCGCWVNGTYYEAGTEFWADTTCSKRCHCGPGGDSLVCKPASCGLGEECALLPSGEIGCQPTSITECQAWGDPHYTTLDGHRFDFQGTCEY

LLSAPCHEPPTGTEYFNVTVANEHRGSQAVSYTRSVTLQIYGLSLTLSAQWPRKLQ VNGEFVALPFHLDQKLSVYISGADVVVNTASGVSLAFDGDSFV

RLRVPAAYAGTLCGLCGNYNKNPNDDLTAVGGKPEGWKVGGAPGCDQCEPEPCPKPCTPEEQEPFRGPDACGIITAPEGPLAPCHSLVPPTQYFEACLLD

ACQVQGHPGGLCPAIATYVAACQAAGAQLGEWRKPDFCP PLQCPAHSHYQLCGDSCPVSCPSLSAPVGCETICREGCVCDAGFVLSGDTCVPVGQCGCL

YQGRYYVLGATFYPGPECERLCECGPDGQVTCQEGADCEPYEECRIENGVQACHPTGCGHCLANGGLHYVTLDGRVYDLHGSCSYVLASVCHPKPGDEEF

SIVLEKNSAGDPQRVVVTVAGQVVGLARGPQ VTVDGEVVTLPVATGHVSVTAEGRNIVLQTNKGMKVLFDGDAHILMSIPSSFRGRLCGLCGNFNGNWS

DDFVLPSGAVAPNVEAFGTAWRAPGSSLGCGEGCGPQGCPVCLAEETQAYEKNDACGKIRDPHGPFAACHKVLSPLEYFRQCVYDMCAHKGDKAYLCRSL

AAYTAACQAAGAAVKPWRTDSVCP PLQCPAHSHYSICTRSCQGSCAALSGLTGCTTRCFEGCECDDHFLLSHGVCIPAQDCGCVHNGQYMP VNSSLMS

SDCSERCFCSPNNGLTCHEAGCPSGHVCEIQAGVRECQAARGLCSISVGANLTTFDGAHNAISSPGVYELSSRCPGLQKNVPWYRVLADVQPCHNNDKIV

SKVHIFFQDGLVTVIPSKGAW - UNI28638 - VNGLRVDLPATVLTSVSVRRMPDGSMLVHQKAGVTVWLGKDGLLDVMVGDDLAAMLCGACGNFDG

DQTNDAYGSQGKTPIEKWRAQDFSPC CSN

For any suggestions or comments, please send an email to unitrap@crg.es