Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047766 (Lrrc49)
Chromosomal location
Chr 9: 60416979 - 60535718 (-)
Description
leucine rich repeat containing 49 Gene [Source:MGI (curated);Acc:Lrrc49-002]
RefSeq_dna
NM_145616 
RefSeq_peptide
NP_663591.2 
MGI
MGI:2442689 
Uniprot/SWISSPROT
Q91YK0 
Human Ortholog
ENSG00000137821 (LRRC49)
Omim not available
UniTrap UNI30875
Vector Insertion
Chr 9: 60469375 - 60497349
Public Clones IST12733H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053171
Sequence
CGCAGTGATCCCTGCTTCCTCCACCGCTTTGTACCTTGCTAGCGCTGGTGCAGCTTGCTCTGCGGATGTGCTGACACCCTCCCACTCGCCTGCTCTGCAG

CAGCAAAGAATGGCTCTCCGAGTCCAGAGGAGATGAAGGGTGTAGCGAGGTTGCAGGAGGGGGAGAGACATGAATATCTTCCAGCAGCTGAACAAGAAGG

CATTTTAATACGATATTTTTTCTTTCAACTGATAAATTTTTGCTTTCTGTTATTTTCTAGAGAGATGTGGATAATTTGCCCTGCCTCCAACGCCTCTTCC

TCAGCTTCAACAATATAACTAG - UNI30875 - CTTTGAAAGTGTTTCCTGCCTTGCCGAGTCAACTTCCCTCTCGGACATCACCTTTGATGGCAAC

CCAATAGCTCAAGAGTCATGGTACAAACACACGGTCCTTCAGAATATGATGCAGCTGCGCCAGCTAGACATGAAGAGAATCACG - UNI30875 - GA

AGAAGAAAGACGCGTGGCATCTGTTGTGGCCAAAAAAGAGGAGGAGAAGAAGAGGGAGAGTCACAAGCAGTCCTTGCTGAAG GAGAAGAAAAGGTTAAC

CATTAACAATGTCGCTCGAAAGTGGGACTTGCAGCAGCGAGTAGCCAACATTGCCAGCACTCAGGACAGAAAGGACTCGGAGTCTCCGCCTCAGGAATCC

TGTCAGCTCGACGGAGGCAACATCTCTGCCTTTCCAGAGGAAGCAGG GTCTCTAGATGCAGGGCTCAGCAGTGCGTTACAAGGCTTGTCTGTCACAGAA

ACACACTTGGTGGAGATAGACGGAGAAACCCTCTCACTGTACGGCTCAGGGGCGCTGGAATGCCTGGATCGAAACTGGAGTGTTCAAACAGCCGGCATGG

TCACCACGGTCTCATTCACGTTCATCGAGTTTGATGAAATTGTCCAAGTACTTCCCAAACTGAAGATGAAGTTTCCAAATTCTCTG CACCTTAAATTCA

GGGAGACCAACCTTGTGATGCTGCAGCAGTTCAATGCCCTGGCACAGCTGCGTCGGGTTGACCAGTTGACAATCGATCCTCAGGGAAACCCAGTGGTCAA

CTTTACACTCTGGAAGTACTACGTGCTGTTCAGGCTCAGCCACTTCAGCATGCAGAAAATAAATGGAACAGAG GTGACTCAAAATGACATGATAATGGC

TGAAAGGCTCTTTGGAATCTTAGCACATGTAGCATCCTCCGAGCTGCCCCAGTACCGCATGATTTCAATTCTGGGTGATGCCAG GAAAAAGCAATTCCG

ATATCTACTGGAAAGCAAAGGTAAAAAGCCTGGCATCATCTGTGAGGAGACCAGTGACAGCAAGAGGTTCTTGGGGGAAAACACGAACCGCGCTACCCTG

AATTACACCACCCGAGAATTCTACCACGAGAAGCTGGAA GAAATAAAGGACAAGAAGAAGTTCTGCAGGTTGTATGTAGAAGACCTGGTGAAGGAAGCC

ACAGCCATCAACATGAAAAACGAGGCTCTGCAGAAGCTGTGGCCACAGATGTTCATCGAGCTTGTGAGAGACGCTGTCATAGAGATCCGCAGCAAGGATT

CCTACATGAAACTCTGCCTGCAGCAGATCACTGACCAGAAATAGGGATGGCTGCTACTTCAGACTTGGGCAATTGGAGCTTTTTCGAAGTTTG GCTTAC

AAGGACACCTTGGCAGCTCATCGCAAGTCTCCATCAGCTCTGCCCATCTCATTCAACAGTGGCTGGGTACCTGTCCTGAGAACTTACGTTGGTGATGGTG

ACCGTTTCAAGGGAGCTATGCAAGACACAAGCAGCACTTGGTTCAGAATTGGCAAGACGCTTTCCTAAGGGTTGGCCAAGATTGATTTGTTACCCTGAGA

AACATTTCTTGAAGACTGGCCTGGGAATGCCTTCCTCAGAGCATTGCTCTTAGATGAGCTATGAGAAGTCTTTAATTTGAGCTGTCTGTCTCCATACCAA

CCTGTGAACAGGCTCCTGGAGGAGTCTTCTGCCTAGCACATTTTGAGACCAGTGTTTTGACCAATGGTGTCATTTGAGTCAAGTGCCTCCGAGCCAGTCC

CTGAAGTCAGGTAAGGAGGCCCTGCAACACGACCCACCTACACCGCCGATGTTACTTGATCAGATGCCAAATGATATAGGCCTGTATTAATATGAGGAAA

TGGTTTTGCAACAAGAAGAAACATTCAAAGAAAGCTTGTCTAAAAAGCTTTAAAGTAGTCACTTCACCCATCTTCAGATGTCAAGGGTTTATACCTGTCT

TCCCACACTACAATGAGGCAGCAGACTTGGGCAGCCACTATTCTAATGGACTTCTTCACCTGTTTGTTAACCTGGCTGTTGGTGTATGGTACAAAGTGTT

TGTGCCAGGAGACGCCACCCACTGTATGAAAAGTTGGGTTTTGTGATATAGCATCTTTCTGGTTTTATTTGGATACAGCCTAGTGTGAGGCTCAAACTCA

CTATGTAGCTAGCATTGAACTTCCACTCTTCCTGCCGCCACATCTTAAGTGCTGGGATTACAAATGCTCACTGTCATACCTGGTTTTGTGCAGTGCTGGG

GAACCCAGGGCTTCCTGCATGCTAGGCAAGCACTCTGCCAACTCAGCCACATCCTCAGCCCCATATAGCATCAAACACAGTGGAAACCATGATTTATCTG

AGAAGTCATTTTCCAAAGCAGATGGCTCTGCAGCCTTGGCAGGATTCCCCTGGGTCTCCTTTCATCTACGTCCTCCCAGGCCCACTGTTTGAAGTAAAAG

AAACCAGGACCCCTCAGAGACAGATGGGCCTGTGTTCAGAGAGTCAAAATGAGTCTGGAATAGCCTCTTGTAACCAGAAAGTCAGGATTTTATTTAAAAA

CTTGTTAGAGGCAGTAGCTGAGGACCAAAGGACCCAACTTAAGGGTCTTTGTGGGTGATGTTGCGACTGTTCAAGCACACAGTATTCATGGTTTTTGAGG

GAAGTTGAAATAAGATAGGGCTTTGAAGGATCAATGTTTTCATAATTATAGGCCAAAAGAAAAATTAAAGTTAGTATAAAATATGAACATTTATATAAAA

TTAAACCTTAGTAGTAATTGT
Translation
 - UNI30875 - MMQLRQLDMKRIT - UNI30875 - EEERRVASVVAKKEEEKKRESHKQSLLK EKKRLTINNVARKWDLQQRVANIASTQDRK

DSESPPQESCQLDGGNISAFPEEAG GSLDAGLSSALQGLSVTETHLVEIDGETLSLYGSGALECLDRNWSVQTAGMVTTVSFTFIEFDEIVQVLPKLKM

KFPNSL HLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTE VTQNDMIMAERLFGILAHVASSELPQYRMI

SILGDAR RKKQFRYLLESKGKKPGIICEETSDSKRFLGENTNRATLNYTTREFYHEKLE EIKDKKKFCRLYVEDLVKEATAINMKNEALQKLWPQMFI

ELVRDAVIEIRSKDSYMKLCLQQITDQK 
Transcript ENSMUST00000114032
Sequence
CCACTTCTTCCTTTTTTTCTATTGAGAAAGGAACCTGTTCTTAGACACTCCCACCTCCTTTATTCAAGCACTGACATCCTGACTGGCAACAGAAATGTCG

GGGCTCCAAAGCCTGAGGTACAAG GTGAACTGTGGACTTCATCTGGTTATTCAAACGTCGTCACTTTCTGACAAAAACAAA GTTGAATTCAGGCTTAA

CAGAGAAACACCACCATTTCCTGGTAGACTGTTACAGCATGACCTGGAGAGGAACTACTCAAGCAGGCAAG GTGACCACATTAGTCTGGTGAGCTCATC

CATGCCGGCGTTTCCTATTCTCCAGCGCTCTTCTGAAGAGAAAACACTTTACTCAGACAGGCTGACCCTAGAAAG ACAAAAGTTGACTGTGTGCCCTAT

CATCGACGGGGAAGAGCACCTTCGTTTGTTGAACTTTCAGCACAATTTTATAACTCGGATCCAAAATATTTCTAATCTACAGAGGCTAATATTCTTGGAC

TTATATGATAACCAGATTGAAGAAATTAGTGGACTTTCTACTCTGAAATCCCTTCGTGTCCTCCTGTTAGGGAAAAACAG AATCAAGAAAATCTCAAAT

CTGGAGAATCTAAAAAATTTAGATGTCTTGGACCTTCATGGAAATCAG ATTACCAAAATTGAAAATGTTAATCATTTGTGTGATTTGAGAGTTCTAAAC

CTTGCCAGGAATCTCTTGAGTCATGTTGACAATCTCAACGGCCTGGATTCACTAACGGAACTTAACCTTCGGCACAACCAGATCACCTTTGTG - UNI3

0875 - AGAGATGTGGATAATTTGCCCTGCCTCCAACGCCTCTTCCTCAGCTTCAACAATATAACTAG - UNI30875 - CTTTGAAAGTGTTTCCT

GCCTTGCCGAGTCAACTTCCCTCTCGGACATCACCTTTGATGGCAACCCAATAGCTCAAGAGTCATGGTACAAACACACGGTCCTTCAGAATATGATGCA

GCTGCGCCAGCTAGACATGAAGAGAATCACG - UNI30875 - GAAGAAGAAAGACGCGTGGCATCTGTTGTGGCCAAAAAAGAGGAGGAGAAGAAGA

GGGAGAGTCACAAGCAGTCCTTGCTGAAG GAGAAGAAAAGGTTAACCATTAACAATGTCGCTCGAAAGTGGGACTTGCAGCAGCGAGTAGCCAACATTG

CCAGCACTCAGGACAGAAAGGACTCGGAGTCTCCGCCTCAGGAATCCTGTCAGCTCGACGGAGGCAACATCTCTGCCTTTCCAGAGGAAGCAGG GTCTC

TAGATGCAGGGCTCAGCAGTGCGTTACAAGGCTTGTCTGTCACAGAAACACACTTGGTGGAGATAGACGGAGAAACCCTCTCACTGTACGGCTCAGGGGC

GCTGGAATGCCTGGATCGAAACTGGAGTGTTCAAACAGCCGGCATGGTCACCACGGTCTCATTCACGTTCATCGAGTTTGATGAAATTGTCCAAGTACTT

CCCAAACTGAAGATGAAGTTTCCAAATTCTCTG CACCTTAAATTCAGGGAGACCAACCTTGTGATGCTGCAGCAGTTCAATGCCCTGGCACAGCTGCGT

CGGGTTGACCAGTTGACAATCGATCCTCAGGGAAACCCAGTGGTCAACTTTACACTCTGGAAGTACTACGTGCTGTTCAGGCTCAGCCACTTCAGCATGC

AGAAAATAAATGGAACAGAG GTGACTCAAAATGACATGATAATGGCTGAAAGGCTCTTTGGAATCTTAGCACATGTAGCATCCTCCGAGCTGCCCCAGT

ACCGCATGATTTCAATTCTGGGTGATGCCAG GAAAAAGCAATTCCGATATCTACTGGAAAGCAAAGGTAAAAAGCCTGGCATCATCTGTGAGGAGACCA

GTGACAGCAAGAGGTTCTTGGGGGAAAACACGAACCGCGCTACCCTGAATTACACCACCCGAGAATTCTACCACGAGAAGCTGGAA GAAATAAAGGACA

AGAAGAAGTTCTGCAGGTTGTATGTAGAAGACCTGGTGAAGGAAGCCACAGCCATCAACATGAAAAACGAGGCTCTGCAGAAGCTGTGGCCACAGATGTT

CATCGAGCTTGTGAGAGACGCTGTCATAGAGATCCGCAGCAAGGATTCCTACATGAAACTCTGCCTGCAGCAGATCACTGACCAGAAATAGGGATGGCTG

CTACTTCAGACTTGGGCAATTGGAGCTTTTTCGAAGTTTGGTAAGATGCAGGTTAGACATGATGAGACACCACCACTACCGCACAGTCTAGAAAGAGTGG

CATCAAAGCCTGCCCCCCCCCCCCCCCCGCACTGTGGAGAAAGGAGGGAGGCAGGAGAGAGGGGGACTCTTTCCCGTGCATGCTGACCACACAACCTTGG

GAAACCAAGCAGCGACTGGAGGAGGCCTGGCTGCTGGGTCAGAAATGCTTCTTCGGCTCCCGCTCTGACTGGTGAGTCTGCCCCAGTCCCAAGCTCGCTG

TGTGCTGATGGGCTAGCATGAGATGCCTCCACCAACCTCCAGCTGAGACTTTCCTCTTTTTTTGCCTTTTTATTTTATGTCATGATTTCAAAGCCAAGCA

TATGTCTTTTTTTAATGAGTGAAGAATAAATACATTAGTT
Translation
MSGLQSLRYK VNCGLHLVIQTSSLSDKNK VEFRLNRETPPFPGRLLQHDLERNYSSRQG GDHISLVSSSMPAFPILQRSSEEKTLYSDRLTLER RQ

KLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNR RIKKISNLENLKNLDVLDLHGNQ ITKIENVN

HLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFV - UNI30875 - RDVDNLPCLQRLFLSFNNITS - UNI30875 - SFESVSCLAES

TSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRIT - UNI30875 - EEERRVASVVAKKEEEKKRESHKQSLLK EKKRLTINNVARKWDLQQ

RVANIASTQDRKDSESPPQESCQLDGGNISAFPEEAG GSLDAGLSSALQGLSVTETHLVEIDGETLSLYGSGALECLDRNWSVQTAGMVTTVSFTFIEF

DEIVQVLPKLKMKFPNSL HLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTE VTQNDMIMAERLFGILAH

VASSELPQYRMISILGDAR RKKQFRYLLESKGKKPGIICEETSDSKRFLGENTNRATLNYTTREFYHEKLE EIKDKKKFCRLYVEDLVKEATAINMKN

EALQKLWPQMFIELVRDAVIEIRSKDSYMKLCLQQITDQK
Transcript ENSMUST00000065603
Sequence
AGCTGTAGGATTACCTCGAAGGAGGATTGAACATCCTGGACTGTCTCCTGCCATGATTCCCGGAAAATATCGCTCCGTTTCTGGCCGAGCTGCAAATAAC

 GTGAACTGTGGACTTCATCTGGTTATTCAAACGTCGTCACTTTCTGACAAAAACAAA GTTGAATTCAGGCTTAACAGAGAAACACCACCATTTCCTGG

TAGACTGTTACAGCATGACCTGGAGAGGAACTACTCAAGCAGGCAAG GAGACGGAAGAGTAATAAGTCCTTCGCCTCGTAATAAGTCATCATGCATCTC

ATCCACAACTAACGTGACAGACCTCTGTGGGCTGGACATGAGAGCTGCCACAACCTCCTTGTCAGCATTTGGAGACTCTTCCATTCAGACACCTTCAAAG

CCGAGAATCCGGCAGGGCTGTCATAGTGCTGGCCCCAATGTATCTG GTGACCACATTAGTCTGGTGAGCTCATCCATGCCGGCGTTTCCTATTCTCCAG

CGCTCTTCTGAAGAGAAAACACTTTACTCAGACAGGCTGACCCTAGAAAG ACAAAAGTTGACTGTGTGCCCTATCATCGACGGGGAAGAGCACCTTCGT

TTGTTGAACTTTCAGCACAATTTTATAACTCGGATCCAAAATATTTCTAATCTACAGAGGCTAATATTCTTGGACTTATATGATAACCAGATTGAAGAAA

TTAGTGGACTTTCTACTCTGAAATCCCTTCGTGTCCTCCTGTTAGGGAAAAACAG AATCAAGAAAATCTCAAATCTGGAGAATCTAAAAAATTTAGATG

TCTTGGACCTTCATGGAAATCAG ATTACCAAAATTGAAAATGTTAATCATTTGTGTGATTTGAGAGTTCTAAACCTTGCCAGGAATCTCTTGAGTCATG

TTGACAATCTCAACGGCCTGGATTCACTAACGGAACTTAACCTTCGGCACAACCAGATCACCTTTGTG - UNI30875 - AGAGATGTGGATAATTTG

CCCTGCCTCCAACGCCTCTTCCTCAGCTTCAACAATATAACTAG - UNI30875 - CTTTGAAAGTGTTTCCTGCCTTGCCGAGTCAACTTCCCTCTC

GGACATCACCTTTGATGGCAACCCAATAGCTCAAGAGTCATGGTACAAACACACGGTCCTTCAGAATATGATGCAGCTGCGCCAGCTAGACATGAAGAGA

ATCACG - UNI30875 - GAAGAAGAAAGACGCGTGGCATCTGTTGTGGCCAAAAAAGAGGAGGAGAAGAAGAGGGAGAGTCACAAGCAGTCCTTGCT

GAAG GAGAAGAAAAGGTTAACCATTAACAATGTCGCTCGAAAGTGGGACTTGCAGCAGCGAGTAGCCAACATTGCCAGCACTCAGGACAGAAAGGACTC

GGAGTCTCCGCCTCAGGAATCCTGTCAGCTCGACGGAGGCAACATCTCTGCCTTTCCAGAGGAAGCAGG GTCTCTAGATGCAGGGCTCAGCAGTGCGTT

ACAAGGCTTGTCTGTCACAGAAACACACTTGGTGGAGATAGACGGAGAAACCCTCTCACTGTACGGCTCAGGGGCGCTGGAATGCCTGGATCGAAACTGG

AGTGTTCAAACAGCCGGCATGGTCACCACGGTCTCATTCACGTTCATCGAGTTTGATGAAATTGTCCAAGTACTTCCCAAACTGAAGATGAAGTTTCCAA

ATTCTCTG CACCTTAAATTCAGGGAGACCAACCTTGTGATGCTGCAGCAGTTCAATGCCCTGGCACAGCTGCGTCGGGTTGACCAGTTGACAATCGATC

CTCAGGGAAACCCAGTGGTCAACTTTACACTCTGGAAGTACTACGTGCTGTTCAGGCTCAGCCACTTCAGCATGCAGAAAATAAATGGAACAGAG GTGA

CTCAAAATGACATGATAATGGCTGAAAGGCTCTTTGGAATCTTAGCACATGTAGCATCCTCCGAGCTGCCCCAGTACCGCATGATTTCAATTCTGGGTGA

TGCCAG GAAAAAGCAATTCCGATATCTACTGGAAAGCAAAGGTAAAAAGCCTGGCATCATCTGTGAGGAGACCAGTGACAGCAAGAGGTTCTTGGGGGA

AAACACGAACCGCGCTACCCTGAATTACACCACCCGAGAATTCTACCACGAGAAGCTGGAA GAAATAAAGGACAAGAAGAAGTTCTGCAGGTTGTATGT

AGAAGACCTGGTGAAGGAAGCCACAGCCATCAACATGAAAAACGAGGCTCTGCAGAAGCTGTGGCCACAGATGTTCATCGAGCTTGTGAGAGACGCTGTC

ATAGAGATCCGCAGCAAGGATTCCTACATGAAACTCTGCCTGCAGCAGATCACTGACCAGAAATAGGGATGGCTGCTACTTCAGACTTGGGCAATTGGAG

CTTTTTCGAAGTTTGGTAAGATGCAGGTTAGACATGATGAGACACCACCACTACCGCACAGTCTAGAAAGAGTGGCATCAAAGCCTGCCCCCCCCCCCCC

CCCGCACTGTGGAGAAAGGAGGGAGGCAGGAGAGAGGGGGACTCTTTCCCGTGCATGCTGACCACACAACCTTGGGAAACCAAGCAGCGACTGGAGGAGG

CCTGGCTGCTGGGTCAGAAATGCTTCTTCGGCTCCCGCTCTGACTGGTGAGTCTGCCCCAGTCCCAAGCTCGCTGTGTGCTGATGGGCTAGCATGAGATG

CCTCCACCAACCTCCAGCTGAGACTTTCCTCTTTTTTTGCCTTTTTATTTTATGTCATGATTTCAAAGCCAAGCATATGTCTTTTTTTAATGAGTGAAGA

ATAAATACATTAGT
Translation
MIPGKYRSVSGRAANN VNCGLHLVIQTSSLSDKNK VEFRLNRETPPFPGRLLQHDLERNYSSRQG GDGRVISPSPRNKSSCISSTTNVTDLCGLDMR

AATTSLSAFGDSSIQTPSKPRIRQGCHSAGPNVSG GDHISLVSSSMPAFPILQRSSEEKTLYSDRLTLER RQKLTVCPIIDGEEHLRLLNFQHNFITR

IQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNR RIKKISNLENLKNLDVLDLHGNQ ITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDS

LTELNLRHNQITFV - UNI30875 - RDVDNLPCLQRLFLSFNNITS - UNI30875 - SFESVSCLAESTSLSDITFDGNPIAQESWYKHTVLQN

MMQLRQLDMKRIT - UNI30875 - EEERRVASVVAKKEEEKKRESHKQSLLK EKKRLTINNVARKWDLQQRVANIASTQDRKDSESPPQESCQLDG

GNISAFPEEAG GSLDAGLSSALQGLSVTETHLVEIDGETLSLYGSGALECLDRNWSVQTAGMVTTVSFTFIEFDEIVQVLPKLKMKFPNSL HLKFRET

NLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTE VTQNDMIMAERLFGILAHVASSELPQYRMISILGDAR RKKQFR

YLLESKGKKPGIICEETSDSKRFLGENTNRATLNYTTREFYHEKLE EIKDKKKFCRLYVEDLVKEATAINMKNEALQKLWPQMFIELVRDAVIEIRSKD

SYMKLCLQQITDQK
Transcript ENSMUST00000114034
Sequence
TTACCTCGAAGGAGGATTGAACATCCTGGACTGTCTCCTGCCATGATTCCCGGAAAATATCGCTCCGTTTCTGGCCGAGCTGCAAATAAC GTGAACTGT

GGACTTCATCTGGTTATTCAAACGTCGTCACTTTCTGACAAAAACAAA GTTGAATTCAGGCTTAACAGAGAAACACCACCATTTCCTGGTAGACTGTTA

CAGCATGACCTGGAGAGGAACTACTCAAGCAGGCAAG GTGACCACATTAGTCTGGTGAGCTCATCCATGCCGGCGTTTCCTATTCTCCAGCGCTCTTCT

GAAGAGAAAACACTTTACTCAGACAGGCTGACCCTAGAAAG ACAAAAGTTGACTGTGTGCCCTATCATCGACGGGGAAGAGCACCTTCGTTTGTTGAAC

TTTCAGCACAATTTTATAACTCGGATCCAAAATATTTCTAATCTACAGAGGCTAATATTCTTGGACTTATATGATAACCAGATTGAAGAAATTAGTGGAC

TTTCTACTCTGAAATCCCTTCGTGTCCTCCTGTTAGGGAAAAACAG AATCAAGAAAATCTCAAATCTGGAGAATCTAAAAAATTTAGATGTCTTGGACC

TTCATGGAAATCAG ATTACCAAAATTGAAAATGTTAATCATTTGTGTGATTTGAGAGTTCTAAACCTTGCCAGGAATCTCTTGAGTCATGTTGACAATC

TCAACGGCCTGGATTCACTAACGGAACTTAACCTTCGGCACAACCAGATCACCTTTGTG - UNI30875 - AGAGATGTGGATAATTTGCCCTGCCTC

CAACGCCTCTTCCTCAGCTTCAACAATATAACTAG - UNI30875 - CTTTGAAAGTGTTTCCTGCCTTGCCGAGTCAACTTCCCTCTCGGACATCAC

CTTTGATGGCAACCCAATAGCTCAAGAGTCATGGTACAAACACACGGTCCTTCAGAATATGATGCAGCTGCGCCAGCTAGACATGAAGAGAATCACG - 

UNI30875 - GAAGAAGAAAGACGCGTGGCATCTGTTGTGGCCAAAAAAGAGGAGGAGAAGAAGAGGGAGAGTCACAAGCAGTCCTTGCTGAAG GAGA

AGAAAAGGTTAACCATTAACAATGTCGCTCGAAAGTGGGACTTGCAGCAGCGAGTAGCCAACATTGCCAGCACTCAGGACAGAAAGGACTCGGAGTCTCC

GCCTCAGGAATCCTGTCAGCTCGACGGAGGCAACATCTCTGCCTTTCCAGAGGAAGCAGG GTCTCTAGATGCAGGGCTCAGCAGTGCGTTACAAGGCTT

GTCTGTCACAGAAACACACTTGGTGGAGATAGACGGAGAAACCCTCTCACTGTACGGCTCAGGGGCGCTGGAATGCCTGGATCGAAACTGGAGTGTTCAA

ACAGCCGGCATGGTCACCACGGTCTCATTCACGTTCATCGAGTTTGATGAAATTGTCCAAGTACTTCCCAAACTGAAGATGAAGTTTCCAAATTCTCTG 

CACCTTAAATTCAGGGAGACCAACCTTGTGATGCTGCAGCAGTTCAATGCCCTGGCACAGCTGCGTCGGGTTGACCAGTTGACAATCGATCCTCAGGGAA

ACCCAGTGGTCAACTTTACACTCTGGAAGTACTACGTGCTGTTCAGGCTCAGCCACTTCAGCATGCAGAAAATAAATGGAACAGAG GTGACTCAAAATG

ACATGATAATGGCTGAAAGGCTCTTTGGAATCTTAGCACATGTAGCATCCTCCGAGCTGCCCCAGTACCGCATGATTTCAATTCTGGGTGATGCCAG GA

AAAAGCAATTCCGATATCTACTGGAAAGCAAAGGTAAAAAGCCTGGCATCATCTGTGAGGAGACCAGTGACAGCAAGAGGTTCTTGGGGGAAAACACGAA

CCGCGCTACCCTGAATTACACCACCCGAGAATTCTACCACGAGAAGCTGGAA GAAATAAAGGACAAGAAGAAGTTCTGCAGGTTGTATGTAGAAGACCT

GGTGAAGGAAGCCACAGCCATCAACATGAAAAACGAGGCTCTGCAGAAGCTGTGGCCACAGATGTTCATCGAGCTTGTGAGAGACGCTGTCATAGAGATC

CGCAGCAAGGATTCCTACATGAAACTCTGCCTGCAGCAGATCACTGACCAGAAATAGGGATGGCTGCTACTTCAGACTTGGGCAATTGGAGCTTTTTCGA

AGTTTGGTAAGATGCAGGTTAGACATGATGAGACACCACCACTACCGCACAGTCTAGAAAGAGTGGCATCAAAGCCTGCCCCCCCCCCCCCCCCGCACTG

TGGAGAAAGGAGGGAGGCAGGAGAGAGGGGGACTCTTTCCCGTGCATGCTGACCACACAACCTTGGGAAACCAAGCAGCGACTGGAGGAGGCCTGGCTGC

TGGGTCAGAAATGCTTCTTCGGCTCCCGCTCTGACTGGTGAGTCTGCCCCAGTCCCAAGCTCGCTGTGTGCTGATGGGCTAGCATGAGATGCCTCCACCA

ACCTCCAGCTGAGACTTTCCTCTTTTTTTGCCTTTTTATTTTATGTCATGATTTCAAAGCCAAGCATATGTCTTTTTTTAATGAGTGAAGAATAAATACA

TTAGTT
Translation
MIPGKYRSVSGRAANN VNCGLHLVIQTSSLSDKNK VEFRLNRETPPFPGRLLQHDLERNYSSRQG GDHISLVSSSMPAFPILQRSSEEKTLYSDRLT

LER RQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNR RIKKISNLENLKNLDVLDLHGNQ IT

KIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFV - UNI30875 - RDVDNLPCLQRLFLSFNNITS - UNI30875 - SFESV

SCLAESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRIT - UNI30875 - EEERRVASVVAKKEEEKKRESHKQSLLK EKKRLTINNVAR

KWDLQQRVANIASTQDRKDSESPPQESCQLDGGNISAFPEEAG GSLDAGLSSALQGLSVTETHLVEIDGETLSLYGSGALECLDRNWSVQTAGMVTTVS

FTFIEFDEIVQVLPKLKMKFPNSL HLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTE VTQNDMIMAERL

FGILAHVASSELPQYRMISILGDAR RKKQFRYLLESKGKKPGIICEETSDSKRFLGENTNRATLNYTTREFYHEKLE EIKDKKKFCRLYVEDLVKEAT

AINMKNEALQKLWPQMFIELVRDAVIEIRSKDSYMKLCLQQITDQK

For any suggestions or comments, please send an email to unitrap@crg.es