Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047773 (AL772375.5)
Chromosomal location
Chr 11: 89282400 - 89500943 (-)
Description
ankyrin-repeat and fibronectin type III domain containing 1  [Source:RefSeq peptide;Acc:NP_001074402]
Human Ortholog
not available
Omim not available
UniTrap UNI38074
Vector Insertion
Chr 11: 89399733 - 89500944
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052158
Sequence
TCTCTATTACAGAGGCTGCCCTTCAAAGACAGACATTTTACTTGCAGCAAAAT - UNI38074 - AATAGGAAGGAGGTTCGCTTGCTTTGCGCAGAG

GCTGAGCTACAGGAGAAAGCAGAGCCAATGTGATTTATTGAATGAAAGCACTGGACACTTACCAGCAACTTGTTCCTCTGCTGCCTCGAAGAGCTTAAGC

TG - UNI38074 - GAACTACTGCTCGAAAATGACCCAGCAAATGCAGAACTTACATCTTTCCCAGTCAAAAAAACACAGTGCTCCATCGTCTCCCAA

TGCTGCCAAGCGACTGTACAGGAACCTCTCGGAGAAGCTGAAGGGCAGTCACTCGTCCTTTGATGAGGCCTATTTTAGAACAAGAACGGATCGGCTGAGT

CTCAGAAAGACTTCTGTG AACTTCCAGGGCAACGAAGCCATGTTTGAGGCAGTTGAGCAACAGGACCTAGATGCTGTGCAACTCCTCCTCTACCAATAT

ACACCGGAAGAACTAGATCTGAACACACCGAACAGCGAAGGGCTGACACCCCTGGACATCGCCATCATGACCAACAACGTGCCCATTGCGAGGATTCTTC

TGCGGACAGGAGCCAGAGAAAGTCCGCACT TTGTCAGCCTGGAGAGCCGAGCAATGCATCTCAACACTCTAGTTCAGGAGGCCCAGGACAGGGTGAGTG

AGCTGTCTGCACAGGTGGAGAATGAAGGCTTCACCCTGGACAACACAGAGAAAGAGAAGCAGCTGAAGGCCTGGGAGTGGAGGTACCGGCTCTACCGGCG

CATGAAAACTGGCTTCGAACATGCCC GAGCCCCAGAGGTGCCAGCCAATGCCTGTCTCATGGTAAGCAGCAGCACGTCCCTAACGGTCAGCTTTCAAGA

GCCCCTCAGTGTCAACGCAGCCGTAGTGACCAGGTACAAAG TGGAATGGAGCATGTCTAAAGACTTTTCCCCGTTGGCTGGGGAGATCATCATGGATAA

CCTGCAGACCCTGAGGTGTACAATCACAGGACTCACCACG GGCCAACAGTATTTTGTTCAAGTCTCAGCTTACAACATGAAAGGATGGGGACCAGCTCA

GACCACAACGCCAGTGTGTGCCTCCCCCTCCA ACTGGAAAGACTATGACGACAGAGAGCCCAGACACAAGGGACAGAGTGAGGTTCTGGAGAGCCTACT

GCAGCAAGTCCGAGCCCTTCATCAGCATTACAGCTGCCGGG AAAGCTCAAAACTGCAAACCACAGGCCGCAAGCAGTCGGTGTCCAGGAGCCTGAAGCA

CCTATTTCATTCCTCAAACAAGTTCGTGAAGACCTTGAAACG AGGACTTTACATAGCCACTATATTTTATTATAAAGACAATATGTTAGTCACCAATGA

AGACCAAATACCAATTGTTGAAATAGATGACTCTCACACCAGTTCTATTACACAAGACTTTCTGTGGTTCATGAAG CTGTCTTGTATGTGGGAAGACAT

CAGGTGGCTGAGGCAAAGCGTGCCCATATCCATGTCCTCGTCCACTGTGCTGCAAACTCGGCAAAAGATGCTTGCTGCCACAGCTCAGCTACAG AATTT

ACTTGGAACACACAACTTGGGAAGACTTTACTATGAGCCCATTAAAGATCGCCATGGCAACATTCTCATAGTTACCATCAGAGAAGTGGAGATGCTTTAT

TCCTTTTTTAATGGCAAATGGATGCAAATCTCAAAACTGCAAAGCCAGAGGAAGTCTCTGTCAACACCCGAAGAGCCAACAGCCTTAGATATTTTACTAA

TAACCATCCAG GATATTCTGTCCTACCACAAGAGGAGCCATCAGCGGCTCTCACCTGGACTGTATCTAGGTTACCTAAAGCTGTGTAGCTCTGTGGATC

AGATCAAAGTGCTCGTAACCCAAAAGCTACCCAACATTCTCTGCCACGTGAAGATCCGTGAAAACCACAACATTTCCAA AGAGGAGTGGGAGTGGATCC

AAAAGCTTTCTGGCTCTGAGTCTATGGAAAGTGTGGATCATAATGCTGACTGCCCCATGCAATTGTTCTTCTACGAGCTCCAGATGGCAGTGGCGGCTCT

CCTGAAGCAGATCAATATACCTCGACACCAG GCAAGGAACTTCCGCCTCTACACACAGGAGGTGTTGGAAATTGGTCACAATGTGTCCTTTCTTCTCTT

GCTCCCTGCCTCAGACGACGTCTGTACAGCCCCAGGACAGAATAATCCTTACACCCCGCACTCAGGGTTTCTTAACCTCCCTCTTCAGATGTTTGAACTC

GGTATAGTAGCTTGTTTCACCTAG
Translation
SLLQRLPFKDRHFTCSKI - UNI38074 - IIGRRFACFAQRLSYRRKQSQCDLLNESTGHLPATCSSAASKSLSW - UNI38074 - WNYCSKMT

QQMQNLHLSQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSV NFQGNEAMFEAVEQQDLDAVQLLLYQYTPEELDLNTPNS

EGLTPLDIAIMTNNVPIARILLRTGARESPHF FVSLESRAMHLNTLVQEAQDRVSELSAQVENEGFTLDNTEKEKQLKAWEWRYRLYRRMKTGFEHAR 

RAPEVPANACLMVSSSTSLTVSFQEPLSVNAAVVTRYKV VEWSMSKDFSPLAGEIIMDNLQTLRCTITGLTT GQQYFVQVSAYNMKGWGPAQTTTPVC

ASPSN NWKDYDDREPRHKGQSEVLESLLQQVRALHQHYSCRE ESSKLQTTGRKQSVSRSLKHLFHSSNKFVKTLKR RGLYIATIFYYKDNMLVTNED

QIPIVEIDDSHTSSITQDFLWFMK LSCMWEDIRWLRQSVPISMSSSTVLQTRQKMLAATAQLQ NLLGTHNLGRLYYEPIKDRHGNILIVTIREVEMLY

SFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQ DILSYHKRSHQRLSPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENHNISK KEEWE

WIQKLSGSESMESVDHNADCPMQLFFYELQMAVAALLKQINIPRHQ ARNFRLYTQEVLEIGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQM

FELGIVACFT

For any suggestions or comments, please send an email to unitrap@crg.es