Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047786 (Lix1)
Chromosomal location
Chr 17: 17539650 - 17596349 (+)
Description
limb expression 1 homolog (chicken) Gene [Source:MGI (curated);Acc:Lix1-001]
RefSeq_dna
NM_025681 
RefSeq_peptide
NP_079957.2 
UniGene
Mm.410701 Mm.435925 Mm.268018 
MGI
MGI:1913893 
Uniprot/SWISSPROT
Q6P566 
Uniprot/SPTREMBL
Q3TSN5 Q9CSQ3 
Human Ortholog
ENSG00000145721 (LIX1)
Omim not available
UniTrap UNI18681
Vector Insertion
Chr 17: 17539991 - 17564119
Public Clones IST13067H10 (tigm) IST12277F7 (tigm) IST12710A11 (tigm) IST14839E10 (tigm)
Private Clones OST418046 (lexicon) OST371431 (lexicon) OST302697 (lexicon) OST279556 (lexicon)
OST262711 (lexicon) OST180643 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18965
Vector Insertion
Chr 17: 17564284 - 17580611
Public Clones IST10591C7 (tigm) IST10767B12 (tigm)
Private Clones OST408602 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13725
Vector Insertion
Chr 17: 17580753 - 17582931
Public Clones CMHD-GT_269F11-3 (cmhd)
Private Clones OST187048 (lexicon) OST136651 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33280
Vector Insertion
Chr 17: 17583028 - 17585999
Public Clones (sanger) IST11826C2 (tigm) IST14302B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16054
Vector Insertion
Chr 17: 17586102 - 17591223
Public Clones (ggtc) CMHD-GT_498F11-3 (cmhd) CMHD-GT_436G1-3 (cmhd)
Private Clones OST467070 (lexicon) OST447673 (lexicon) OST339093 (lexicon) OST293610 (lexicon)
OST286642 (lexicon) OST260993 (lexicon) OST179702 (lexicon) OST179693 (lexicon)
OST176117 (lexicon) OST175021 (lexicon) OST129420 (lexicon) OST54135 (lexicon)
OST24099 (lexicon) OST17276 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37300
Vector Insertion
Chr 17: 17591302 - 17594069
Public Clones CMHD-GT_269G11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097389
Sequence
ATGCCCTTGGATTTTCTGTGGGCCAGTCCTGCTGCGCTGAGGAACCGCAATAGGCTTCAGCTTTCCTTCACTCCTTGGGAGGGAAGGAGTGCCTATTGTG

AG - UNI16054 - GAACTAATGACCATTTTCCAACTACTGCACTGGAATGGAAGCCTGAAAGCCCTCCGTGAAACAAAGTGCTCTCGACAG GAAGT

CATCTCCTACTATTCCCAATATTCTTTAGATGAAAAGATGCGTAGCCACATGGCCCTGGACTGGATTATGAAGGAGCGTGAATCACCAGGAATTCTCTCT

CAAGAGCTGCGTGCAGCCCTAGGGCAGCTGGAGGAAGCCAGGAAGGCTGGACAAGAACTACGATTTTACAAAGAAAAAAAAGAAATCCTGAGCTTGGCCC

TGACTCAGATCTATAGTGACCCTGACCCTTCCTCACCCAGTGATGACCAGCTAAGCCTCACGGCTCTGTGTGGCTATCATTAGCAAGGCCAGGTGGCAGG

TTTCCTGAGGACGTTCACATCAGGAATCTACCTGACAGAAGTTGTTAGAGATTTTAGCATGATAGTCAGTACCTGAAGGCTGTACTGCTCCTACACAGTC

TGTTCACAGAATGGGAGGCTAGGGTTGACTGATCCCGATCCCAACTTCCTACTTCATGTATGTTTTCAACCATTCCCTTAGGGATTCTACTTCAGAATAA

AAAGAAAGACAACAAAATTACTTTAGAAAGCATTCTTCAGGGTTTGATCTAATCTAAAAAACCTAGTTGATATGTGCCTTGCTAAATTGTATGCATTGCT

TCACACAACAGTCCAGTAGAGCAGTCTTGGAGAAAACAGCAGCCAGGACTAGGGAAAGGATCATGATAACTTCTTTTTTTCTTTTTTTTTGGGGGGGCAC

AGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTTGTCTTTAGATCAGGCTGGCCTTGAACTCAGAGCTCTGCTTCTGAGTACTAGGATTAACTACATCT

ACCACAACCACCTGGCCTATAACAATGTTTTAAATACTTAAGAGTAAATAAATAGTACAGATGATTTAAAAAAAATGTACAACACTCAGCATGTTTTGAA

CCCTCCTGAAAATTACTGTATCCTCATTATATATTTTGAAATTAGCTTTAATAACAAACACTATCACATATACTTCTCAGACAGGATGAAATTAAGTACA

TAACTGCCCTATTCCAATGTCCTAAAAAGGTGATGGTGTGTAGTGTTAGATGATTTCATTTTAAAATGATATTTTTTTAAAAATCATATCACTTCCCATA

ATGAGGCTAAATGTTCTAAGGAAAAAAAAACTTTAGATTTTTGTAATCTTGAGAAGGAGTTAGGATTTGTGTGTGTGTTGAATAAATTTTTAAGTGAAGA

AATTTCTATTTCATTTTTTTTTTTACAAACTTTTTATCATTTCAAATTCAGCACATTTCCCCATGTTGGCTGGGATCTTTACGTGCAGTGCATGTTTACT

GTGTTTGGCAATGTCCACCTCAGAAGATTGATATCTGATTAGATGCAAGAACAGTGCTTGCGTGGGTCAAGCTTCTCCTCTCTTTTATAATTATGACACT

GTACAAATTCTCTGAACTGAAAATTACGTAGACTATTTTTCCTTGGAATATTCTCAGAAACTTCAGCAAAAGCAACAAAGGTTATGGCCATGGCTGGCCC

TATCTAATAGCAAATCAACTTCAGCCAGGGCATTGTGCCAACCGAGTATCACACATGTCTGTAACACTGGCACAGAGGAACCTAAGAGAGGGACAAGACA

AACACGCACGCTTGTTCTTAACACTGCACTGTAGAAAGGGACAAGAATAAAGGAGTCTCTAAGAAGATGGAGCCATGAAGGTGGTGCTTGTTGTTGCTAT

GAACTCCCTGAAAATTGAATAAAAAGCCACAGACTATCTCATAGCAATATATAATAATTTCATAAAACATATGGCCCTGCCCCAAAATTTATGGATTAGC

CCAGAGCATCATTGACCCTTAGTTTGAAGCTCACAATTTTAAAAGCATACATAGTTTTACACTTCATATGAGAGATCTAGTAACCCATAGACCATATATT

TTTTTCTTTTCTTTTCTTTCTTTTTTTTTTTTTTTCCGAGACAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCAGACTGGCC

TCGAACTCAGAAATCTGCCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACTGCCTGGCCATAGACCATATTTTTAAGATTACTACC

ATTACTCTGAAATCAAGAATTGTATTGTTTGGGGCATGATGGTTTAATTTTTATAAAAATCAAAATGCACCTTGTTGTTATGGAGAAAGAAATTAAGACA

AACTAGACACTAAACTTTGGCAACTGTACCAGAACATTACAGATTTAATAAAATCATTGTTCCTTCAATATTCTG
Translation
MPLDFLWASPAALRNRNRLQLSFTPWEGRSAYCE - UNI16054 - ELMTIFQLLHWNGSLKALRETKCSRQ EVISYYSQYSLDEKMRSHMALDWIM

KERESPGILSQELRAALGQLEEARKAGQELRFYKEKKEILSLALTQIYSDPDPSSPSDDQLSLTALCGYH
Transcript ENSMUST00000115576
Sequence
GTGTTTAACAGAACGAAGCCATGGGAACCAGCCTGTCAGCCAGCCTTTCAGGCTAATTAGCTCAGCATACAACAAAGATAAGTGAGCCTGAGAGGAGGGC

CCTGAGGGTCTTTAGATTCTGGGAAATGTCTGATTGGCAGATGTTAAAAGGGATTCTTTAGTAATCCACTGCATCAATGAGCTGCACAAATTCAGTCCAG

AGCTGCAAGAATTCAGGCATGAGGAGACTGTGCAGGAGGCTTGCACAGGCAGACTCGAGATGGACAGAACCTTGGAATCTCTGAGGCACATCATTGCCCA

AGCCTTGCCTCACAGAGACCCGGCTTTGGTCTTCAAAGACT - UNI18681 - TGAATGTTGTGTCAATGTTACAGGAATTTTGGGAAAGCAAGCAGC

AGCAGAAAGCCACCTTCTCCAGTGAGGGACTGGTGGTCTATGAGTCAATGCCTTCCTCTGGGCCTCCCTTTGTGAGCTATGTGACTCTCCCTGGAGGGAG

CTGCTTTGGCAACTTTCAG - UNI18965 - TGCTGCTTAAGTAGAGCTGAGGCCAGGCGGGATGCTGCTAAAGTGGCGCTCATCAACTCTCTCTTCA

ATGAGCTACCCTCCCGAAGGATCACCAAGGAGTTCATCATGGAGAGTGTTCAGGAAGCAGTAGCCTCCACCAGG - UNI13725 - GGCACGTTAGAT

GATGCGGATGACCCAAGCACAAGTGTGGGAGCCTATCACTACATGCTGGAGTCAAACATGGGGAAGACTATGCTGGAGTTTCAG - UNI16054 - - 

UNI33280 - GAACTAATGACCATTTTCCAACTACTGCACTGGAATGGAAGCCTGAAAGCCCTCCGTGAAACAAAGTGCTCTCGACAG GAAGTCATCT

CCTACTATTCCCAATATTCTTTAGATGAAAAGATGCGTAGCCACATGGCCCTGGACTGGATTATGAAGGAGCGTGAATCACCAGGAATTCTCTCTCAAGA

GCTGCGTGCAGCCCTAGGGCAGCTGGAGGAAGCCAGGAAGGCTGGACAAGAACTACGATTTTACAAAGAAAAAAAAGAAATCCTGAGCTTGGCCCTGACT

CAGATCTATAGTGACCCTGACCCTTCCTCACCCAGTGATGACCAGCTAAGCCTCACGGCTCTGTGTGGCTATCATTAGCAAGGCCAGGTGGCAGGTTTCC

TGAGGACGTTCACATCAGGAATCTACCTGACAGAAGTTGTTAGAGATTTTAGCATGATAGTCAGTACCTGAAGGCTGTACTGCTCCTACACAGTCTGTTC

ACAGAATGGGAGGCTAGGGTTGACTGATCCCGATCCCAACTTCCTACTTCATGTATGTTTTCAACCATTCCCTTAGGGATTCTACTTCAGAATAAAAAGA

AAGACAACAAAATTACTTTAGAAAGCATTCTTCAGGGTTTGATCTAATCTAAAAAACCTAGTTGATATGTGCCTTGCTAAATTGTATGCATTGCTTCACA

CAACAGTCCAGTAGAGCAGTCTTGGAGAAAACAGCAGCCAGGACTAGGGAAAGGATCATGATAACTTCTTTTTTTCTTTTTTTTTGGGGGGGCACAGTTT

CTCTGTGTAGCCCTGGCTGTCCTGGAACTTGTCTTTAGATCAGGCTGGCCTTGAACTCAGAGCTCTGCTTCTGAGTACTAGGATTAACTACATCTACCAC

AACCACCTGGCCTATAACAATGTTTTAAATACTTAAGAGTAAATAAATAGTACAGATGATTTAAAAAAAATGTACAACACTCAGCATGTTTTGAACCCTC

CTGAAAATTACTGTATCCTCATTATATATTTTGAAATTAGCTTTAATAACAAACACTATCACATATACTTCTCAGACAGGATGAAATTAAGTACATAACT

GCCCTATTCCAATGTCCTAAAAAGGTGATGGTGTGTAGTGTTAGATGATTTCATTTTAAAATGATATTTTTTTAAAAATCATATCACTTCCCATAATGAG

GCTAAATGTTCTAAGGAAAAAAAAACTTTAGATTTTTGTAATCTTGAGAAGGAGTTAGGATTTGTGTGTGTGTTGAATAAATTTTTAAGTGAAGAAATTT

CTATTTCATTTTTTTTTTTACAAACTTTTTATCATTTCAAATTCAGCACATTTCCCCATGTTGGCTGGGATCTTTACGTGCAGTGCATGTTTACTGTGTT

TGGCAATGTCCACCTCAGAAGATTGATATCTGATTAGATGCAAGAACAGTGCTTGCGTGGGTCAAGCTTCTCCTCTCTTTTATAATTATGACACTGTACA

AATTCTCTGAACTGAAAATTACGTAGACTATTTTTCCTTGGAATATTCTCAGAAACTTCAGCAAAAGCAACAAAGGTTATGGCCATGGCTGGCCCTATCT

AATAGCAAATCAACTTCAGCCAGGGCATTGTGCCAACCGAGTATCACACATGTCTGTAACACTGGCACAGAGGAACCTAAGAGAGGGACAAGACAAACAC

GCACGCTTGTTCTTAACACTGCACTGTAGAAAGGGACAAGAATAAAGGAGTCTCTAAGAAGATGGAGCCATGAAGGTGGTGCTTGTTGTTGCTATGAACT

CCCTGAAAATTGAATAAAAAGCCACAGACTATCTCATAGCAATATATAATAATTTCATAAAACATATGGCCCTGCCCCAAAATTTATGGATTAGCCCAGA

GCATCATTGACCCTTAGTTTGAAGCTCACAATTTTAAAAGCATACATAGTTTTACACTTCATATGAGAGATCTAGTAACCCATAGACCATATATTTTTTT

CTTTTCTTTTCTTTCTTTTTTTTTTTTTTTCCGAGACAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCAGACTGGCCTCGAA

CTCAGAAATCTGCCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACTGCCTGGCCATAGACCATATTTTTAAGATTACTACCATTAC

TCTGAAATCAAGAATTGTATTGTTTGGGGCATGATGGTTTAATTTTTATAAAAATCAAAATGCACCTTGTTGTTATGGAGAAAGAAATTAAGACAAACTA

GACACTAAACTTTGGCAACTGTACCAGAACATTACAGATTTAATAAAATCATTGTTCCTTCAATATTCTG
Translation
MDRTLESLRHIIAQALPHRDPALVFKDL - UNI18681 - LNVVSMLQEFWESKQQQKATFSSEGLVVYESMPSSGPPFVSYVTLPGGSCFGNFQ - 

UNI18965 - CCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMESVQEAVASTR - UNI13725 - GTLDDADDPSTSVGAYHYMLESNMGKTM

LEFQ - UNI16054 - - UNI33280 - ELMTIFQLLHWNGSLKALRETKCSRQ EVISYYSQYSLDEKMRSHMALDWIMKERESPGILSQELRAAL

GQLEEARKAGQELRFYKEKKEILSLALTQIYSDPDPSSPSDDQLSLTALCGYH

For any suggestions or comments, please send an email to unitrap@crg.es