Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047789 (Slc38a9)
Chromosomal location
Chr 13: 113450984 - 113523106 (+)
Description
solute carrier family 38, member 9 Gene [Source:MGI Symbol;Acc:MGI:1918839]
RefSeq_dna
NM_178746 
RefSeq_peptide
NP_848861.1 
UniGene
Mm.259799 Mm.397671 
MGI
MGI:1918839 
Uniprot/SWISSPROT
Q8BGD6 
Human Ortholog
ENSG00000177058 (SLC38A9)
Omim not available
UniTrap UNI8089
Vector Insertion
Chr 13: 113459940 - 113476273
Public Clones RRF540 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28888
Vector Insertion
Chr 13: 113504456 - 113513405
Public Clones not available
Private Clones OST17140 (lexicon) OST17134 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052514
Sequence
GGACTATTCTCTCTAAGCCGCTGCCAACTGAGAGGTCTGTGAAAGGGTCTTCGCCTCCTGCTCTGGTTTTCCGACGTAGAGGGATTGGCCTGCTGAG GA

CTGGCTGCCCCAGTGCCTGGAATCTGAGGGAAAATGGCAAGTGTGGATGGTGATTCCAGGCATCTTCTCTCTGAGGTGGAACATGAAGTAAGCCCTGGGC

CTATGAACATCCAGTTTGATTCATCAGATCTGAGATCTAAAAG - UNI8089 - GCCTTTCTATATAGAGCCTACCAACATTGTCAATGTGAATGATG

TCATTCAGAGGGTTAGTGACCATGCTGCTGCTATGAACAAGCGGATTCATTACTACAGCCGGCTCACCACTCCTGCAGACAAGGCACTG ATTGCTCCAG

ACCATGTCGTCCCTGCTCCAGAGGAATGCTATGTGTATAGTCCATTGGGCTCTGCCTATAAACTCAAGAGTTACACTGAAGGCTATGGTAAAAACACCAG

CTTAGTTACTAT TTTTATGATTTGGAATACCATGATGGGAACATCTATACTAAGTATTCCTTGGGGCATAAAACAG GCTGGATTTACCACTGGGATGT

GTGTCATCGTGCTGATGGGCCTTCTAACACTTTACTGCTGCTATAGAGTGGTGAAGTCACGGAGTACGATAA GTACATCGGACACGAGTACCTGGGAAT

ATCCAGATGTCTGCAAACATTATTTTGGCTCCTTTGGGCAATGGTCAAGTCTCCTTTTCTCCTTGGTGTCGCTCATTGGAGCAATGATAGTTTATTGGGT

GCTTATGTCTAATTTTCTTTTTAATACTGGAAAGTTTATTTTTA ATTTTATTCATCACATTAATGACACAGACACTGTACTGAGCACCAATAATAGCAA

CCCTG TGATATGTCCAAATGCTGGCAGTGGTGGCCGTCCTGACAACAGTTCCATGATTTTCTACAACAACAACACAGAAGTGCAGCTGTTTGAGAAGTG

GTGGGACAAGTCCAGGACAGTGCCCTTCTACCTTATAGGGCTCCTCTTGCCGCTGCTCAACTTCAAGTCTCCTTCATTCTTCTCCAAATTTAATATCCTG

G GAACGGTGTCTGTCCTCTATTTGATTTTCGTTGTTACCCTGAAGGCTGTTCGCTTAGGATTCCATCTGGAATTTCACTGGTTTGTGCCAACAGAATTT

TTTGTACCAG AGATAAGAGCTCAGTTTCCGCAGCTGATGGGGGTGCTTACTCTGGCCTTCTTTATTCACAACTGCATCATCACACTCTTGAAAAACAAC

AAGAACCAAGAAAATAAT - UNI28888 - GTGAGAGACCTATGCATTGCTTATATGCTGGTGACATTGACTTATCTCTATATTGGTATCCTGGTTTT

TGCCTCATTCCCTTCGCCTCCATTACCCAAAGATTGTATTGAACAG AACTTCTTAGACAACTTCCCCAGCAGTGACATCCTGTCCTTCATTGCAAGGAT

ATTCCTGCTGTTCCAGATGATGACTGTATATCCGCTCTTAGGCTACTTGGCTCGTGTCCAGCTCTTGGGCCATATCTTCGGTGACATTTATCCTAG CAT

TTTCCATGTGCTGATTCTTAACTTAGTTATTGTGGGAGCTGGAGTGACCATGGCCTGTTTCTACCCAAACATAGGAGGGATCATAAG GTATTCGGGAGC

AGCATGCGGCCTGGCTTTCGTGTTCATATACCCGTCTCTCATCTATATAATCTCCCTTCACCAAGAGGAGCGTCTGACATGGCCTAAGTTGGTGTTTCAC

GTTATCATCATCATTTTGGGCCTGGCGAACCTGATTGCTCAGTTTTTCATGTGAAAACTCTCTTCTCAAGATTTCTCGTGGTATTCTGAACCTTGGCAAC

GGTTCTGCATAAAAGAACTTGAAAATGCTGTCATTGCTGTAATTCTAAGTGTTCTTCTAAGATAATTGAAAGCGAGGGAAATGATGGTCTCTCATAAGTA

TTTTTGTACTCGTGCTGGGAGGGCGTAAGTATTAAGGATGGTTCTTCTCAGTGACCCTCATTCCCATGTATCCAAGTAGACATGTGGGAGGGATCATACT

GATATTTATGTTAAGTTAGGTGGGTGTGTTTCACCCACAGCAAGGAATCTCAGGGGTCTTGGGTCAGGGCTGTTGCCAGACCCTGTGTGTGCTTCCATGT

GGGCTCTTCCACCTTCTTACTTGCTGGGCCATTTCCCCAGTTTGCCCAAAGCTCAACTGTCTCCAACAGTAAAACCAAATACCTCATTTTAAAAGAAGTT

TCCATGGCATCATTATTAATGGGATGAATTCCTAACTCAACACTTAACCTGAAGAACAAAAAACTTTAAATAGTGTCAGTCCGTCAGAAGCTATGTGTCA

GCTAGGGCCAGTGAGGTGGCTGGTGTGTCCGGGAGCACCTTGATGGTAGGCTGAGAGGGTCTAGGGGTTAAGGTCATCCCCAGTTTGCCTCTTGGGGGGA

TGGGCTGTTTGTTGGGTTTAGGGTTTTTTGTTTTGTTTTTTTTCCTTGAGAAAGCCTTTCTGTATGTATCCCTGGCTGTCCTGAAACTTGCTCTTAGGAC

CAGTCTGGTTATGGCCAGTTTGAAACCAGCCTGGTCTATATAAAGCCTTGTATCAAGACACTAAAAGAGAAGAGAGAAAACCAAAAGAAATTAGGTGTCA

GATCAACTTGTAGAGTCCATTGCTATCTGACTCTTAATTCAAATCCAGCCCCAATGGCTTAGGTTGAGGTTACAATTCCCAAGCCCAGATCTCACACCTG

AACAAAAGCAGTTGTCCTCGATTCTTGCCCTTGAGAACTGCATGGACTGTCATGAAGCCCAATGGAAGAAGCACAAGTGGAGATGGGCATGTGAGGCTCT

TCAAAAGGGAAAGGAATCTGCCCAGTGTGCCCGAGTCATCCTGGTTCAGGTGTGGCCTCCAGGAGCCAACACCCTCTACCTGCTTCTAGAGCAGAAAGAG

AAGAGTTAGGTCTCACAAGAAAAGCTTCTGACAAGATGACTGAGAAATGCAGATTCTTAGACTTAACACTCTTGCCATCTTCCTTCTG
Translation
 MASVDGDSRHLLSEVEHEVSPGPMNIQFDSSDLRSKR - UNI8089 - RPFYIEPTNIVNVNDVIQRVSDHAAAMNKRIHYYSRLTTPADKAL IAP

DHVVPAPEECYVYSPLGSAYKLKSYTEGYGKNTSLVTI IFMIWNTMMGTSILSIPWGIKQ AGFTTGMCVIVLMGLLTLYCCYRVVKSRSTIS STSDT

STWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFN NFIHHINDTDTVLSTNNSNPV VICPNAGSGGRPDNSSMIFYNNNT

EVQLFEKWWDKSRTVPFYLIGLLLPLLNFKSPSFFSKFNILG GTVSVLYLIFVVTLKAVRLGFHLEFHWFVPTEFFVPE EIRAQFPQLMGVLTLAFFI

HNCIITLLKNNKNQENN - UNI28888 - VRDLCIAYMLVTLTYLYIGILVFASFPSPPLPKDCIEQ NFLDNFPSSDILSFIARIFLLFQMMTVYPL

LGYLARVQLLGHIFGDIYPS SIFHVLILNLVIVGAGVTMACFYPNIGGIIR RYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLVFHVIIIILGLA

NLIAQFFM

For any suggestions or comments, please send an email to unitrap@crg.es