Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047804 (Akap10)
Chromosomal location
Chr 11: 61684809 - 61743728 (-)
Description
A kinase (PRKA) anchor protein 10 Gene [Source:MGI (curated);Acc:Akap10-001]
RefSeq_dna
NM_019921 
RefSeq_peptide
NP_064305.2 
UniGene
Mm.274404 Mm.474925 
MGI
MGI:1890218 
Uniprot/SWISSPROT
O88845 
Uniprot/SPTREMBL
Q3TR91 
Human Ortholog
ENSG00000108599 (AKAP10)
Omim not available
UniTrap UNI5377
Vector Insertion
Chr 11: 61743490 - 61743729
Public Clones CSI150 (baygenomics) CSI867 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14307
Vector Insertion
Chr 11: 61736283 - 61743729
Public Clones FHCRC-GT-S20-2F1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30053
Vector Insertion
Chr 11: 61736283 - 61743729
Public Clones D137D03 (ggtc) IST14490F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25025
Vector Insertion
Chr 11: 61729585 - 61729721
Public Clones not available
Private Clones OST197801 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34193
Vector Insertion
Chr 11: 61729585 - 61736332
Public Clones IST12378E8 (tigm) IST12002E11 (tigm) IST12393E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5285
Vector Insertion
Chr 11: 61723449 - 61728525
Public Clones YTB011 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI704
Vector Insertion
Chr 11: 61718362 - 61723349
Public Clones DB0215 (sanger) YTC257 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9099
Vector Insertion
Chr 11: 61713949 - 61717408
Public Clones XK510 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9212
Vector Insertion
Chr 11: 61691529 - 61700201
Public Clones RRC139 (baygenomics)
Private Clones OST321840 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108710
Sequence
GAACTCTAAGCGGGTGGCTTGTTGATAACATGGCGGCAGCAGCTGCCGGGGCATCCCGAGGTGGCGGCAGCGCCCACACCCGGAAGAAGGGGCTGTTTTC

GGACTAGTGCAGCGGCTCCTGCGGCCCCGGAAGTCCCGGCCAGCTGCTGAATGAGGGGAGCCGGGCCCTCCCCGCGACACTCCCCCCGCGCCCTCCGCCC

CGACCCGGGCCCCGCCATGTCCTTCTTCCGGCGGAAAG - UNI5377 - - UNI14307 - - UNI30053 - - UNI34193 - TGAAAGGTAA

AGAGCAAGAGAAGACCTTAGATGTCAAGTCCACTAAAG - UNI14307 - - UNI30053 - - UNI34193 - CTTCAGTAGCCGTACATTCCCC

ACAAAAAAGCACTAAAAATCATGCCTTGCTGGAGGCTGCAGGACCAAGTCATGTTGCGATCAATGCCATTTCTGCCAACATGGACTCCTTTTCAAGTAGC

AGGACAGCAACGCTTAAGAAACAGCCAAGCCACATGGAGGCTGCTCATTTTGGAGACCTAG - UNI25025 - - UNI34193 - GCAGATCCTGTC

TGGACTATCAGACTCAAGAGACCAAATCCAGTCTTTCAAAGACCCTTGAACAAGTCTTGCGTGACACTGTTGTCCTTCCATATTTCCTTCAGTTTATGGA

ACTTCGGAGAATGGAGCACCTGGTGAAATTTTGGTTAGAGGCTGAAAGTTTTCACTCTACAACGTGGTCCCGAATAAGAGCACACAGTCTAAACACAGTG

AAACAGAGTTCACTGGCTGAGCCTGTCTCTCCATCTAAAAGACATGAGACTCCAGCATCTTCTGTAACTGAGGCTCTTGACAGGAGGTTGGGGGATTCTA

GCTCAGCCCCACTGCTTGTGACTCAATCAGAAGGAACTGACCTGAGTAGTAGAACTCAGAACCCTCAGAACCACTTGCTGCTTTCCCAGGAAGGCCACAG

TGCCCGTTCTCTCCATCGTGAGGTGGCCAGAACAGGAAGTCATCAGATTCCCACCGACTCCCAGGACTCCTCCTCCAGACTTGCAGTAGGCAGTAGAAAC

AGTTGCTCTTCTCCACTGAGAGAACTGTCAGAAAAACTAATGAAAA - UNI5285 - GTATAGAACAAGATGCAGTGAATACTTTTACCAAATATATA

TCTCCAGATGCTGCTAAGCCAATACCAATTACAGAAGCCATGAGAAACGACATCATCG - UNI704 - CAAAGATTTGTGGAGAAGATGGACAGGTGG

ATCCCAACTGTTTCGTTCTGGCACAGGCTGTAGTCTTTAGTGCAATGGAGCAAGA GCACTTTAGTGAGTTTCTGCGAAGTCACCATTTCTGTAAATACC

AGATTGAAGTGCTGACCAGTGGGACTGTTTACCTGGCTGATATCCTCTTCTGTGAGTCAGCCCTCTTTTATTTTTCTGAG - UNI9099 - TACATGG

AAAAAGAAGATGCAGTGAATATCTTACAATTCTGGTTAGCAGCGGATAATTTCCAGTCTCAGCTTGCTGCCAAAAAGGGCCAGTATGATGGACAGGAGGC

CCAGAATGATGCCATGATTTTATATGACAA GTACTTTTCCCTCCAAGCCACACACCCCCTTGGATTTGATGATGTTGTACGATTAGAAATTGAATCTAA

TATCTGCAGGGAAGGTGGACCACTTCCTAATTGTTTCACAACTCCATTACGTCAGGCCTGGACAACCATGGAGAAG GTCTTTTTGCCTGGTTTTCTGTC

CAGCAATCTTTATTACAAATATTTGAATGATCTCATCCATTCAGTTCGAGGAGATGAATTTCTTGGAGGGAATGTTTCCCTGGCTGCTCACGGCTCTGTC

TGCCTTCCTGAGGAGTCTCACTCAGGTGGTTCCGATGGCTCCACTGCTCAGGTATTAGCCAATGTCACTCTATCAATGGGATGGGAGGCATAGAGAGCCT

CTCCTCCAAATGCCAGCAGTAGATCCCATTCGTATGTTTTAAGTAGTAGATAGAAGAAAATAAAATCAGCTTATTTGTAAACTCTAGTCAGACTGTAAAT

AGTAATTAGGCTTCTACTATATTGTAAAGTATTATGTTCTGTCATAAAAGCTGTTCATCTGTTGGACAACATGCCTTTTTGTTTTAGTGACAAAGTATGT

GTGTGTACATGCTCAAAAGTGCAGAGGACAGGTCAGCCTTGGATGTTACTCCTCAGACATTATTCACCTTGGTTTTTGACATAGGGTCTCTCACTGGCCC

TGACTTAACATTAGGTTAGGTTGGCTGACCAGCAAGGCCTAGGAATCTGCCAGCCTCTACCTCCCCAGTTGACACTCTTGCATGGCTTTTGGATTGACCT

GACTGTGTTGACAGTGACGTATACGGAGAAGCTGGGTCAGATGGGCTGTGAACTTTGATGGATGCATTAGCAGCCCAGACAACACTCAGCATCTCTGTTA

TACACAGCGAAACAAGGAGGTGGCTTTTTTATATACAGCTGAATCTCAGTACAGGGGCCTCCGTAGGGTAGCAGTCTTGGCTATAATCATGCAGAGAGCA

GCAGCTGTGGTTGATATTTCCTGCATACAGCTGTCACTATCCATACTTAGACCAAGGAAAAGCATTGCCATTCCTTTGGTTCTGAAGCACTGCTGCCCTT

AACATGACCATGGTCACATCCATAGTACACATTCTCTCAGGGTGCTCCCTCAGGGTGTTGTCTGGGATTATAAACACTCCACCATGGCCAGATTCTTTGT

GTGGGTCCTGGGGCTAGACCTTAGATTTTATGCTTGCATAACAAGCACTTTTCTCTCTCTTCAGCCCAGTAATCAAGCTCTACAGAGCTGGGGGGTTTTT

TGTTTTGTTTTGTTTTTAGACTTATTTATTTATTTATTTAATGTATATAGGTACACTGTAGCTGAACAGATGGTTGTGAGCCTTCGTGTGGTTGTTCGGA

ATTGATTTTTCTTTTTTAGGACCTCTGCCCACTCCAGTTGACCCTACTCGCTCCAGTCAACTCCACTTGCTCAGTCCTTGCTCCTGCTTATTATACATAA

GTATACTGTAGCTGTCTTCAGACATGCCATTCCCTTTATGAGTGGTTGTGAGCCATCATGTGGTTGCTGGGATTTGAACTCAGAACCTTCAGAAGAGCAA

TCAGTGCTCTTACCCACTGAGCCATCTCGCCAGCCCCCCAGAGCTGTTTTTATAACTTGAGAAATTTTAATAACTGAGTTTAAGATACTTTATTACTAGT

GAACTCAGACTGTTTTAATTTATTTAAAACATGTGTGATGTGTGTGTGAGTGCAGGCACATACATGTCACGGTGTGAGTGTGGAAGCCAGAGGAGAACTT

GCAGTGGTCTGTTTCAGGTTCTAGGATTGTAACTCATATCCTCCCTCAGGCTTCCAGGGTGAGCACTTTGACCTGCTCATCTGTTTCATTGAGGGCGCTT

CCTTACTACTTTCAGAATTGTTTCCAACTAGAATGCTATGTTATGTCTCCCTTT
Translation
MRGAGPSPRHSPRALRPDPGPAMSFFRRKV - UNI5377 - - UNI14307 - - UNI30053 - - UNI34193 - VKGKEQEKTLDVKSTKA 

- UNI14307 - - UNI30053 - - UNI34193 - ASVAVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDL

G - UNI25025 - - UNI34193 - GRSCLDYQTQETKSSLSKTLEQVLRDTVVLPYFLQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVK

QSSLAEPVSPSKRHETPASSVTEALDRRLGDSSSAPLLVTQSEGTDLSSRTQNPQNHLLLSQEGHSARSLHREVARTGSHQIPTDSQDSSSRLAVGSRNS

CSSPLRELSEKLMKS - UNI5285 - SIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIA - UNI704 - AKICGEDGQVDPNCFVLAQAVVFSAM

EQE EHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSE - UNI9099 - YMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAM

ILYDK KYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEK VFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLAAHGSVCLP

EESHSGGSDGSTAQVLANVTLSMGWEA
Transcript ENSMUST00000058173
Sequence
TGCTGGAGGCTGCAGGACCAAGTCATGTTGCGATCAATGCCATTTCTGCCAACATGGACTCCTTTTCAAGTAGCAGGACAGCAACGCTTAAGAAACAGCC

AAGCCACATGGAGGCTGCTCATTTTGGAGACCTAG - UNI25025 - - UNI34193 - GCAGATCCTGTCTGGACTATCAGACTCAAGAGACCAAA

TCCAGTCTTTCAAAGACCCTTGAACAAGTCTTGCGTGACACTGTTGTCCTTCCATATTTCCTTCAGTTTATGGAACTTCGGAGAATGGAGCACCTGGTGA

AATTTTGGTTAGAGGCTGAAAGTTTTCACTCTACAACGTGGTCCCGAATAAGAGCACACAGTCTAAACACAGTGAAACAGAGTTCACTGGCTGAGCCTGT

CTCTCCATCTAAAAGACATGAGACTCCAGCATCTTCTGTAACTGAGGCTCTTGACAGGAGGTTGGGGGATTCTAGCTCAGCCCCACTGCTTGTGACTCAA

TCAGAAGGAACTGACCTGAGTAGTAGAACTCAGAACCCTCAGAACCACTTGCTGCTTTCCCAGGAAGGCCACAGTGCCCGTTCTCTCCATCGTGAGGTGG

CCAGAACAGGAAGTCATCAGATTCCCACCGACTCCCAGGACTCCTCCTCCAGACTTGCAGTAGGCAGTAGAAACAGTTGCTCTTCTCCACTGAGAGAACT

GTCAGAAAAACTAATGAAAA - UNI5285 - GTATAGAACAAGATGCAGTGAATACTTTTACCAAATATATATCTCCAGATGCTGCTAAGCCAATACC

AATTACAGAAGCCATGAGAAACGACATCATCG - UNI704 - CAAAGATTTGTGGAGAAGATGGACAGGTGGATCCCAACTGTTTCGTTCTGGCACAG

GCTGTAGTCTTTAGTGCAATGGAGCAAGA GCACTTTAGTGAGTTTCTGCGAAGTCACCATTTCTGTAAATACCAGATTGAAGTGCTGACCAGTGGGACT

GTTTACCTGGCTGATATCCTCTTCTGTGAGTCAGCCCTCTTTTATTTTTCTGAG - UNI9099 - TACATGGAAAAAGAAGATGCAGTGAATATCTTA

CAATTCTGGTTAGCAGCGGATAATTTCCAGTCTCAGCTTGCTGCCAAAAAGGGCCAGTATGATGGACAGGAGGCCCAGAATGATGCCATGATTTTATATG

ACAA GTACTTTTCCCTCCAAGCCACACACCCCCTTGGATTTGATGATGTTGTACGATTAGAAATTGAATCTAATATCTGCAGGGAAGGTGGACCACTTC

CTAATTGTTTCACAACTCCATTACGTCAGGCCTGGACAACCATGGAGAAG GTCTTTTTGCCTGGTTTTCTGTCCAGCAATCTTTATTACAAATATTTGA

ATGATCTCATCCATTCAGTTCGAGGAGATGAATTTCTTGGAGGGAATGTTTCCCTGGCTGCTCACGGCTCTGTCTGCCTTCCTGAGGAGTCTCACTCAGG

TGGTTCCGATGGCTCCACTGCTCAG TCTAGTGTGAAAAAAGCCAGTATTAAAATTCTGAAAAATTTTGATGAAGCAATAATTGTGGATGCTGCAAGTCT

GGACCCAGAATCTTTATATCAACGGACATATGCAGGGTAAGCTTAATTCGGCATGTAGAATTTAGCATTTTTTATGTTTTTTTAAAAAGTTTAAATGCCC

AGCATTTTCACATGCCATGTGATATAGTAGTTAAAAGGAAGCCAGGCATTGTGGCCTACCTTTAATCTCAGCACTCAAGAGACCAAGACAAATGGATCTT

TGTAAATTCAAGACCAGCTTGGTCTCCATAGTGAATTCCCTGCCAGCCAAGGTTACACAGTGAGATCCTGTCTGAAAAAAATAAATAAATAAATAGGACA

AAAAGGATGGCTTTGGGGCCAGCAGGCCTGAAGGACCTGAGTTCAGTCAGTTCCTGGAACCATGGTGGAAAGAGAGAATCATCTCCTTGATGTTTTCATC

TGACCTCCAATGCATGTTATGGCATGTGCATAACTGGATTCACACACATACCAGGCACATGTATATAACAACAATAAATTTACC
Translation
MDSFSSSRTATLKKQPSHMEAAHFGDLG - UNI25025 - - UNI34193 - GRSCLDYQTQETKSSLSKTLEQVLRDTVVLPYFLQFMELRRMEHL

VKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKRHETPASSVTEALDRRLGDSSSAPLLVTQSEGTDLSSRTQNPQNHLLLSQEGHSARSLHRE

VARTGSHQIPTDSQDSSSRLAVGSRNSCSSPLRELSEKLMKS - UNI5285 - SIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIA - UNI704 -

 AKICGEDGQVDPNCFVLAQAVVFSAMEQE EHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSE - UNI9099 - YMEKEDAVNILQFW

LAADNFQSQLAAKKGQYDGQEAQNDAMILYDK KYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEK VFLPGFLSSNLYYKYLN

DLIHSVRGDEFLGGNVSLAAHGSVCLPEESHSGGSDGSTAQ SSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAG
Transcript ENSMUST00000102650
Sequence
GAACTCTAAGCGGGTGGCTTGTTGATAACATGGCGGCAGCAGCTGCCGGGGCATCCCGAGGTGGCGGCAGCGCCCACACCCGGAAGAAGGGGCTGTTTTC

GGACTAGTGCAGCGGCTCCTGCGGCCCCGGAAGTCCCGGCCAGCTGCTGAATGAGGGGAGCCGGGCCCTCCCCGCGACACTCCCCCCGCGCCCTCCGCCC

CGACCCGGGCCCCGCCATGTCCTTCTTCCGGCGGAAAG - UNI5377 - - UNI14307 - - UNI30053 - - UNI34193 - TGAAAGGTAA

AGAGCAAGAGAAGACCTTAGATGTCAAGTCCACTAAAG - UNI14307 - - UNI30053 - - UNI34193 - CTTCAGTAGCCGTACATTCCCC

ACAAAAAAGCACTAAAAATCATGCCTTGCTGGAGGCTGCAGGACCAAGTCATGTTGCGATCAATGCCATTTCTGCCAACATGGACTCCTTTTCAAGTAGC

AGGACAGCAACGCTTAAGAAACAGCCAAGCCACATGGAGGCTGCTCATTTTGGAGACCTAG - UNI25025 - - UNI34193 - GCAGATCCTGTC

TGGACTATCAGACTCAAGAGACCAAATCCAGTCTTTCAAAGACCCTTGAACAAGTCTTGCGTGACACTGTTGTCCTTCCATATTTCCTTCAGTTTATGGA

ACTTCGGAGAATGGAGCACCTGGTGAAATTTTGGTTAGAGGCTGAAAGTTTTCACTCTACAACGTGGTCCCGAATAAGAGCACACAGTCTAAACACAGTG

AAACAGAGTTCACTGGCTGAGCCTGTCTCTCCATCTAAAAGACATGAGACTCCAGCATCTTCTGTAACTGAGGCTCTTGACAGGAGGTTGGGGGATTCTA

GCTCAGCCCCACTGCTTGTGACTCAATCAGAAGGAACTGACCTGAGTAGTAGAACTCAGAACCCTCAGAACCACTTGCTGCTTTCCCAGGAAGGCCACAG

TGCCCGTTCTCTCCATCGTGAGGTGGCCAGAACAGGAAGTCATCAGATTCCCACCGACTCCCAGGACTCCTCCTCCAGACTTGCAGTAGGCAGTAGAAAC

AGTTGCTCTTCTCCACTGAGAGAACTGTCAGAAAAACTAATGAAAA - UNI5285 - GTATAGAACAAGATGCAGTGAATACTTTTACCAAATATATA

TCTCCAGATGCTGCTAAGCCAATACCAATTACAGAAGCCATGAGAAACGACATCATCG - UNI704 - CAAAGATTTGTGGAGAAGATGGACAGGTGG

ATCCCAACTGTTTCGTTCTGGCACAGGCTGTAGTCTTTAGTGCAATGGAGCAAGA GCACTTTAGTGAGTTTCTGCGAAGTCACCATTTCTGTAAATACC

AGATTGAAGTGCTGACCAGTGGGACTGTTTACCTGGCTGATATCCTCTTCTGTGAGTCAGCCCTCTTTTATTTTTCTGAG - UNI9099 - TACATGG

AAAAAGAAGATGCAGTGAATATCTTACAATTCTGGTTAGCAGCGGATAATTTCCAGTCTCAGCTTGCTGCCAAAAAGGGCCAGTATGATGGACAGGAGGC

CCAGAATGATGCCATGATTTTATATGACAA GTACTTTTCCCTCCAAGCCACACACCCCCTTGGATTTGATGATGTTGTACGATTAGAAATTGAATCTAA

TATCTGCAGGGAAGGTGGACCACTTCCTAATTGTTTCACAACTCCATTACGTCAGGCCTGGACAACCATGGAGAAG GTCTTTTTGCCTGGTTTTCTGTC

CAGCAATCTTTATTACAAATATTTGAATGATCTCATCCATTCAGTTCGAGGAGATGAATTTCTTGGAGGGAATGTTTCCCTGGCTGCTCACGGCTCTGTC

TGCCTTCCTGAGGAGTCTCACTCAGGTGGTTCCGATGGCTCCACTGCTCAG TCTAGTGTGAAAAAAGCCAGTATTAAAATTCTGAAAAATTTTGATGAA

GCAATAATTGTGGATGCTGCAAGTCTGGACCCAGAATCTTTATATCAACGGACATATGCAGG GAAGATGTCCTTTGGGAGAGTTAGTGATTTGGGGCAG

TTCATCCGAGAGTCTGAGCCTGAACCTGATGTGAAGAAATCAAAAG - UNI9212 - GATTCATGTTCTCACAAGCTATGAAGAAGTGGGTGCAAGGA

AATACTGACGAG GCCCAAGAAGAGCTAGCTTGGAAGATTGCAAAAATGATAGTGAGTGATGTTATGCAGCAGGCACACCATGATCAACCACTAGAGAAG

TCTACAAAG CTATGACTCGAAACCAGAGATAAGGAAATCTGATTTTGAAAAAAATAAGAACTTTCCCCTTTGGTTGGATTCTTCAACACAGCCGATGAA

AACGGAGCACTGCATTTCTTTTCACTGCTAGATCACTGTTGTTTCCAGGGAAGAGTGGGAGACAGTCCGAGAGTGGTTGTTAAATGTAGACATAGATGAC

ACACATGACAGTAACACAGTGAGTCCCGAGATACAAAGTGGTGGTGGCGACTTATTAGACCATTTTCCAGTGGCCACGCTCACTGGGGTAGACAGGGACC

ACATGCTCGCAGCAGATTACTTCCTCAGCTGTGTCAGAAAGCATGACAGAGGTGCTTCATTCTTGTCTCCTAGAGGTCACAGGTGAGTCAGCCCTGCCTG

GAGCGAGCATCTCCAAGTGGCAGTGTGGGCCAGCAGCCTGTGGAGCAGAGGACAATTCCTTGCCTAGTCTTCCTTCACAGAAGCATTAATTTAGAAAGCT

GGCAAGTCGTGGGTCAAGCCTCAGTGTTGCATCCTTTCCTTCGCTGACAGAACACACTGTTCACCTTTCCTTCACTCCCGAGGTGATCGATCCTTAAAGC

TAGTCCTTCCTCTGCTGACAAGAGGGCGAGTTTAGTTTACTTTGAGCATCAAGACCCATTCCGCTATCAGAACGCTATGCTCCAGACGCTTCATTCCCTC

TTCAGAATACACATGGAAAAAATGAGCACTCCAGTTTTTCCCTGTGGTCCTTAGAACACATTCACAAAATTGGTTTTATTTTTTAATAAGGTGGGGACAG

AAGCACTCCCTTGTGGGTGTCTCCCCAATTCTTCACTGTGAGTGGGAAATGTGCAGTTGCCTTTTCCCTCCCTGTCTTAAGACAGTAGGAGACTCACTCG

CTGCCCTTCTGCTTAGTTGGCTTTGCACTTGTGGCACAGCCGTTGGCGGGGCCACCCCGCTGGCAAGCACACTCCCCCAGCCTCACGGTGCCAGTGCTTC

CTTGTGTGTAACAGCTTAGAGAGAAAGGAAGTTTTCTTAGGTGTTATTGCTTTTGCTCAGAATTTGCAAAAGGGTGTGTGTGTGTGTGTGTGTGTGTGTG

TGTGTGTATACACACATGTACATATATAATTATTAATCACCTCTGTCCTTGGGGAAAGTCTTGAATGAACAGAAAATTTATTTCATTGCAATATTGATTG

TACAGAGGCACACTGTTCAACAGAAGAAGCAAAAAGGCTGTGTATAAGTTTTTGGTACTATGTACCATCTCTGTTATTCTGAAGTATTCATGTACTTAAA

CCATATTCTATTTAATTGTGTTTGATTTTAAATATATATATATATGAATTATATTTAAAATGGTGTCAACTTCCTGCTTTCAGGGCATTTCTGGCTCTCC

TGTTGAAGTATATTGACCCTTCCTAATATTTCCACTTGTTTTACAAAACTCCAGAACATAATCCCCAATTGGACATAGCCTTGTGTTTGGGTGTAGACAT

AGACATGAGGTTTTAATTAGTGTATGTGCTGTTGTGGCTCTTCTGTTCCTTTAACAAAGCATTTCTCTCCATTTCATATCGCTTCAAACTTTAAGTGAAA

AGCAACATAAAGACATAGAGTCAAACGTGATTCTGAGTGTCCTCTGCCTTTGCATGCTTCAGGGTAAAAAATCTGTAATGCTCTCGGCTGTTTAAACTAG

TGGGTTTGTTAAAATACTTTCTAGT
Translation
MRGAGPSPRHSPRALRPDPGPAMSFFRRKV - UNI5377 - - UNI14307 - - UNI30053 - - UNI34193 - VKGKEQEKTLDVKSTKA 

- UNI14307 - - UNI30053 - - UNI34193 - ASVAVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDL

G - UNI25025 - - UNI34193 - GRSCLDYQTQETKSSLSKTLEQVLRDTVVLPYFLQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVK

QSSLAEPVSPSKRHETPASSVTEALDRRLGDSSSAPLLVTQSEGTDLSSRTQNPQNHLLLSQEGHSARSLHREVARTGSHQIPTDSQDSSSRLAVGSRNS

CSSPLRELSEKLMKS - UNI5285 - SIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIA - UNI704 - AKICGEDGQVDPNCFVLAQAVVFSAM

EQE EHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSE - UNI9099 - YMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAM

ILYDK KYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEK VFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLAAHGSVCLP

EESHSGGSDGSTAQ SSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAG GKMSFGRVSDLGQFIRESEPEPDVKKSKG - UNI9212 - GFMFS

QAMKKWVQGNTDE AQEELAWKIAKMIVSDVMQQAHHDQPLEKSTK L

For any suggestions or comments, please send an email to unitrap@crg.es