Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000047907 (Tshz2)
Chromosomal location
Chr 2: 169458671 - 169738594 (+)
Description
teashirt zinc finger family member 2 Gene [Source:MGI (curated);Acc:Tshz2-002]
RefSeq_peptide
NP_536703.2 
UniGene
Mm.315789 
MGI
MGI:2153084 
Uniprot/SWISSPROT
Q68FE9 
Uniprot/SPTREMBL
A2AHS1 A2AHS3 Q3TSK2 Q8BIK5 Q8BU55 Q8K350 A2AHS4 
Human Ortholog
ENSG00000182463 (TSHZ2)
Omim not available
UniTrap UNI32122
Vector Insertion
Chr 2: 169459280 - 169616465
Public Clones IST11589E8 (tigm) IST11858E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17219
Vector Insertion
Chr 2: 169714005 - 169738107
Public Clones not available
Private Clones OST447455 (lexicon) OST102841 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17484
Vector Insertion
Chr 2: 169738107 - 169738594
Public Clones not available
Private Clones OST441893 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087966
Sequence
ATGCCAAGGAGGAAACAGCAGGCACCCAAGCGGGCGGCAG - UNI32122 - GGTATGCCCAGGAGGAAGTCCTGAAGGAAGAGGAGGAAATAAAGGA

AGAGGAGGAGGAAGAAGAAGACAGTGGCTCCGTTGCTCAACACCAGAGCAGCAATGACACTGGGACAGACGAGGAACTAGAAACGGGCCCAGAGCAGAAA

GGCTACTTCAGCTGCCAGAACTCACCGGGGAGCCACCTGTCCAATCAGGATGCAGAAAACGAGTCTCTCCTGAGCGATGCCAGCGACCAGGTGTCAGACG

TCAAAAGTGTCTGTGGCCGAGATGTTTCAGACAAGAAAGCAAACACTCACCCCAAACTTCCAAGCGAACCCCATAACTGCATGGATAAAATGACAGCTGT

CTATGCCAATATCCTGTCAGATTCCTACTGGTCGGGCCTGGGCCTCGGCTTCAAGTTATCCAACAGTGAGAGACGGAATTGCGACACCC TCGTGGAGCT

GACCGTGCACATGAACGAGACAGGCCACTATCAAGATGACAACCGCAAAAAAGATAAGCTCAGACCCACGAGCTACTCCAAGCCCCGAAAAAGGGCCTTC

CAAGACATGGACAAAGAGGATGCCCAAAAGGTCCTGAAATGTATGTTTTGTGGTGACTCCTTCGATTCCCTGCAAGATTTGAGTGTCCACATGATAAAGA

CAAAACATTACCAAAAAGTGCCTTTGAAGGAGCCGGTACCAACCATTTCCTCCAAGATGGTCACACCAGCCAAGAAGCGTGTTTTCGATGTCAACAGGCC

TTGCTCCCCTGACTCCACCACAGGGTCCCTTGCAGATTCCTTTTCTTCCCAGAAGAGTGCTAACCTGCAGCTGCCCTCCAACAGCCGCTACGGCTACCAA

AACGGCGCCAGCTACACCTGGCAGTTCGAGGCCTGCAAGTCCCAGATCTTAAAGTGTATGGAGTGTGGCAGTTCCCATGATACTTTGCAACAACTCACCA

CCCACATGATGGTCACAGGCCACTTTCTCAAAGTCACTAGCTCTGCCTCCAAGAAAGGAAAGCAACTTGTGTTGGACCCCCTAGCTGTGGAGAAAATGCA

GTCACTGTCTGAGACCCCAAACAGTGAGTCTCTGGCCCCTAAGCCATCAAGTAACTCCCCCTCGGAGTGCACAGCCTCTACCACCGAGTTAAAGAAAGAA

AGCAAGAAGGAGAAGGGAGAGGGCATTGAAGACGAACAAGGTGTGAAAAGCGAGGACTACGAAGACTCTCTACAGAAACCTCTCGACCCCACCATAAAAT

ACCAGTACCTAAGAGAGGAGGACTTGGAAGACGGCTCGAAGGGTGGTGGGGACATTTTAAAGTCACTGGAAAATACCGTAACCACAGCCATCAACAAGGC

CCAGAATGGTGCTCCCAGCTGGAGCGCATACCCAAGTATCCACGCAGCCTACCAGCTCTCAGAGGGCACCAAGCCACCTATGGCAATGGGCTCTCAGATA

CTGCAAATCCGACCCAACCTCGCCAACAAGCTGAGGCCCATTGCACCCAAATGGAAAGGTATGCCACTCGGCCCTGTCCCCACAAGCCTGGCTCTGTACA

CTCAAGTCAAGAAGGAGACAGAAGACAAAGATGAAGTCGTGAAGCAGTGTGGGAAGGAAAGTCCCCACGAAGAGGCAACATCTTTCAGTCAGCCTGAGGG

CGAGTCTTTCTCCAAAATTGAACCACCTTCAGAATCCAGAAAGGCTGAGCCCTGTCCCCTGAAAGAGGAGGAGAAGCCGCAGAAAGAGAAACCGGAGCCC

TTAGAACCAGTATCTTCTCTGACCAATGGCTGTGCGCCGGCTAACCACACCCCGGCTCTGCCTTCCATCAACCCGCTCAGTGCCCTGCAGTCCGTCCTGA

ACAACCACCTGGGCAAAGCCACGGAGCCCTTGCGCTCCCCTTCCTGCTCCAGTCCCAACTCAAGCACAAGCCCCGTGTTCCATAAATCCAGCCTCCACGT

GGTGGACAAGCCGGTCATAAGTCCCACCTCCACCAGGCCGGCGGCCAGCGTGGCCAGACACTACCTGTTTGAGAACACCGACCAGCCCATTGACCTGACC

AAGTCCAAAAGCAAGAGAGCCGAGTCCTCGCAAGCACAATCCTGCACGTCCCCACCTCAGAAGCATGCTCTGTGTGACATTGCTGATATGGTCAAGGTCC

TCCCCAAAGCCACCACCCCAAAGCCAGCCGCCTCCTCGAGGGTCCCTCCTATGAAGCTGGAAATCGACGTCAGACGCTTCGAGGATGTTTCGAGCGAAGT

CTCCACTTTGCACAAAAGGAAAGGCCGGCAGTCCAACTGGAACCCCCAGCATCTTCTCATCCTGCAAGCTCAGTTTGCCTCGAGCCTCTTCCAGACCTCA

GAGGGCAAATACCTGCTTTCTGACCTGGGCCCCCAAGAGCGGATGCAAATCTCCAAGTTCACCGGACTCTCCATGACCACAATCAGCCACTGGCTGGCTA

ACGTCAAATACCAGCTTAGGAAAACAGGTGGGACAAAGTTCCTGAAAAACATGGACAAAGGGCACCCCATCTTTTACTGCAGTGACTGTGCGTCCCAGTT

CAGAACCCCCTCTACCTACATCAGCCACCTAGAGTCTCACCTGGGCTTCCAAATGAAGGACATGACCCGGATGGCGGCTGACCAGCAAAGCAAGGTGGAG

CAGGAGATCTCCCGAGTGTCGTCGGCTCAGAGGTCTCCAGAAACAATAGCTGGCGAAGAGGACACAGACTCTAAATTCAAGTGTAAGTTATGCCGTCGGA

CATTTGTGAGCAAACACGCAGTAAAACTCCACCTAAGCAAAACGCACAGCAAGTCACCCGAACACCACTCTCAGTTTGTAGCAGACGTGGATGAAGAATA

G
Translation
MPRRKQQAPKRAAG - UNI32122 - GYAQEEVLKEEEEIKEEEEEEEDSGSVAQHQSSNDTGTDEELETGPEQKGYFSCQNSPGSHLSNQDAENESL

LSDASDQVSDVKSVCGRDVSDKKANTHPKLPSEPHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTL LVELTVHMNETGHYQDDNRKKDKLR

PTSYSKPRKRAFQDMDKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSLADSFSSQKSAN

LQLPSNSRYGYQNGASYTWQFEACKSQILKCMECGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLVLDPLAVEKMQSLSETPNSESLAPKPSSNSPS

ECTASTTELKKESKKEKGEGIEDEQGVKSEDYEDSLQKPLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSAYPSIHAAYQLSE

GTKPPMAMGSQILQIRPNLANKLRPIAPKWKGMPLGPVPTSLALYTQVKKETEDKDEVVKQCGKESPHEEATSFSQPEGESFSKIEPPSESRKAEPCPLK

EEEKPQKEKPEPLEPVSSLTNGCAPANHTPALPSINPLSALQSVLNNHLGKATEPLRSPSCSSPNSSTSPVFHKSSLHVVDKPVISPTSTRPAASVARHY

LFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKVLPKATTPKPAASSRVPPMKLEIDVRRFEDVSSEVSTLHKRKGRQSNWNPQHLLIL

QAQFASSLFQTSEGKYLLSDLGPQERMQISKFTGLSMTTISHWLANVKYQLRKTGGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDM

TRMAADQQSKVEQEISRVSSAQRSPETIAGEEDTDSKFKCKLCRRTFVSKHAVKLHLSKTHSKSPEHHSQFVADVDEE
Transcript ENSMUST00000109159
Sequence
GAGGAGGAGAAGGAGGAGAAGGAGAAGGAGGAGAAGGAGGAGGTGGTAAAGGAAGAGGAGGTGGAGGAAGAGGAGGAAGAAGAGGAGGAGGGAAAGAGAA

GGAAGAAGAAAAAGAAGAAATCCACTGTCTTCCCGGGATTGTTTCCCCCCTTATCTTTAAGCGCGAGTGTGCGCGTGGCGCGTGTGCGCCCCTCATCCCT

GCCATCTGAACCCCGTCTTGGATGTTTAATAAAGAAATCAAGTGTCTCACCAGTCACCAAAAAAACAGCAAAAAGCAAAACCAAAAAAAGAAAAAAATCC

AAAAGCAAAACAAAAAGAGAGGGGGAAAAAAAACCAAACAAACAAACAAGGCAGAACCAACCTCCACTTGCAAGCAGCAGGCGCGAGCCACATATCTGCC

ACCCAGAGAGGGGGTCTCCGGCCCCGCGCTGGAGCGCTGGCAGGGGGATCTTCAGGGGGACAGAGGCCGAGTGACGTCCTAGGAGCCACAGAAAGACGAG

CGAGACTGCGGCCCCCGCGCGCGGCTCGGGGCTGGGGCGCCAGAAGTGAGACTGGAGCTAAGTAGAGCGATGCCAAGGAGGAAACAGCAGGCACCCAAGC

GGGCGGCAG - UNI32122 - GGTATGCCCAGGAGGAAGTCCTGAAGGAAGAGGAGGAAATAAAGGAAGAGGAGGAGGAAGAAGAAGACAGTGGCTCC

GTTGCTCAACACCAGAGCAGCAATGACACTGGGACAGACGAGGAACTAGAAACGGGCCCAGAGCAGAAAGGCTACTTCAGCTGCCAGAACTCACCGGGGA

GCCACCTGTCCAATCAGGATGCAGAAAACGAGTCTCTCCTGAGCGATGCCAGCGACCAGGTGTCAGACGTCAAAAGTGTCTGTGGCCGAGATGTTTCAGA

CAAGAAAGCAAACACTCACCCCAAACTTCCAAGCGAACCCCATAACTGCATGGATAAAATGACAGCTGTCTATGCCAATATCCTGTCAGATTCCTACTGG

TCGGGCCTGGGCCTCGGCTTCAAGTTATCCAACAGTGAGAGACGGAATTGCGACACCCGCAACAGCAGCGGCAAGAATGATTTTGATTGGCACCAAGATG

CCCTGTCCAAAAGCCTGCAGCAGAACTTGCCTTCCCGGTCTGTCTCTAAGCCCAGCCTATTCAGCTCCGTGCAGCTATACCGGCAGAGCAGTAAGTTGTG

TGGCTCGGTGTTCACCGGCGCCAGCAGGTTCCGCTGCAGGCAGTGCAGTGCGGCCTACGACACTCTCGTGGAGCTGACCGTGCACATGAACGAGACAGGC

CACTATCAAGATGACAACCGCAAAAAAGATAAGCTCAGACCCACGAGCTACTCCAAGCCCCGAAAAAGGGCCTTCCAAGACATGGACAAAGAGGATGCCC

AAAAGGTCCTGAAATGTATGTTTTGTGGTGACTCCTTCGATTCCCTGCAAGATTTGAGTGTCCACATGATAAAGACAAAACATTACCAAAAAGTGCCTTT

GAAGGAGCCGGTACCAACCATTTCCTCCAAGATGGTCACACCAGCCAAGAAGCGTGTTTTCGATGTCAACAGGCCTTGCTCCCCTGACTCCACCACAGGG

TCCCTTGCAGATTCCTTTTCTTCCCAGAAGAGTGCTAACCTGCAGCTGCCCTCCAACAGCCGCTACGGCTACCAAAACGGCGCCAGCTACACCTGGCAGT

TCGAGGCCTGCAAGTCCCAGATCTTAAAGTGTATGGAGTGTGGCAGTTCCCATGATACTTTGCAACAACTCACCACCCACATGATGGTCACAGGCCACTT

TCTCAAAGTCACTAGCTCTGCCTCCAAGAAAGGAAAGCAACTTGTGTTGGACCCCCTAGCTGTGGAGAAAATGCAGTCACTGTCTGAGACCCCAAACAGT

GAGTCTCTGGCCCCTAAGCCATCAAGTAACTCCCCCTCGGAGTGCACAGCCTCTACCACCGAGTTAAAGAAAGAAAGCAAGAAGGAGAAGGGAGAGGGCA

TTGAAGACGAACAAGGTGTGAAAAGCGAGGACTACGAAGACTCTCTACAGAAACCTCTCGACCCCACCATAAAATACCAGTACCTAAGAGAGGAGGACTT

GGAAGACGGCTCGAAGGGTGGTGGGGACATTTTAAAGTCACTGGAAAATACCGTAACCACAGCCATCAACAAGGCCCAGAATGGTGCTCCCAGCTGGAGC

GCATACCCAAGTATCCACGCAGCCTACCAGCTCTCAGAGGGCACCAAGCCACCTATGGCAATGGGCTCTCAGATACTGCAAATCCGACCCAACCTCGCCA

ACAAGCTGAGGCCCATTGCACCCAAATGGAAAGGTATGCCACTCGGCCCTGTCCCCACAAGCCTGGCTCTGTACACTCAAGTCAAGAAGGAGACAGAAGA

CAAAGATGAAGTCGTGAAGCAGTGTGGGAAGGAAAGTCCCCACGAAGAGGCAACATCTTTCAGTCAGCCTGAGGGCGAGTCTTTCTCCAAAATTGAACCA

CCTTCAGAATCCAGAAAGGCTGAGCCCTGTCCCCTGAAAGAGGAGGAGAAGCCGCAGAAAGAGAAACCGGAGCCCTTAGAACCAGTATCTTCTCTGACCA

ATGGCTGTGCGCCGGCTAACCACACCCCGGCTCTGCCTTCCATCAACCCGCTCAGTGCCCTGCAGTCCGTCCTGAACAACCACCTGGGCAAAGCCACGGA

GCCCTTGCGCTCCCCTTCCTGCTCCAGTCCCAACTCAAGCACAAGCCCCGTGTTCCATAAATCCAGCCTCCACGTGGTGGACAAGCCGGTCATAAGTCCC

ACCTCCACCAGGCCGGCGGCCAGCGTGGCCAGACACTACCTGTTTGAGAACACCGACCAGCCCATTGACCTGACCAAGTCCAAAAGCAAGAGAGCCGAGT

CCTCGCAAGCACAATCCTGCACGTCCCCACCTCAGAAGCATGCTCTGTGTGACATTGCTGATATGGTCAAGGTCCTCCCCAAAGCCACCACCCCAAAGCC

AGCCGCCTCCTCGAGGGTCCCTCCTATGAAGCTGGAAATCGACGTCAGACGCTTCGAGGATGTTTCGAGCGAAGTCTCCACTTTGCACAAAAGGAAAGGC

CGGCAGTCCAACTGGAACCCCCAGCATCTTCTCATCCTGCAAGCTCAGTTTGCCTCGAGCCTCTTCCAGACCTCAGAGGGCAAATACCTGCTTTCTGACC

TGGGCCCCCAAGAGCGGATGCAAATCTCCAAGTTCACCGGACTCTCCATGACCACAATCAGCCACTGGCTGGCTAACGTCAAATACCAGCTTAGGAAAAC

AGGTGGGACAAAGTTCCTGAAAAACATGGACAAAGGGCACCCCATCTTTTACTGCAGTGACTGTGCGTCCCAGTTCAGAACCCCCTCTACCTACATCAGC

CACCTAGAGTCTCACCTGGGCTTCCAAATGAAGGACATGACCCGGATGGCGGCTGACCAGCAAAGCAAGGTGGAGCAGGAGATCTCCCGAGTGTCGTCGG

CTCAGAGGTCTCCAGAAACAATAGCTGGCGAAGAGGACACAGACTCTAAATTCAAGTGTAAGTTATGCCGTCGGACATTTGTGAGCAAACACGCAGTAAA

ACTCCACCTAAGCAAAACGCACAGCAAGTCACCCGAACACCACTCTCAGTTTGTAGCAGACGTGGATGAAGAATAGTTCTGCAG - UNI17219 - - 

UNI17484 - AGTTCTACAGCCTCCAACACGAGACTGAAAGCCAGGCTGCGGTGGATGGACCAGGATGCTGCGGGTTGACCAGACTGCTGCGGGTGGAC

CAGGCTGCTGCGGGTGGACCAGGCTGCTGCGGGTGGACCAGGCTGCTGCGGGTGGACCAGGCTGCTGCGGGTGGGCCTCGCTGCAGTTGCTGCGGATGGA

TCTGATGCCTGTTAAGCATCACTTCTCCAGTGTGAGCCCGCCACCTCCATTTCCGTCACGTGTGCCCATCTTTTTCAGTCTAATGAACTCCAACCATCAG

CGCAACTTAAGTTCGGCTGTCTGTTCGTGCATGCTTAATATTAAAAATGTACTAACAGTGTGGCTGAGAAATCAAATTATGCACATAAATATGCTGGCAT

AGCAGAGGCGGCGGCAGAAGCTGAACTTAGCAGAGCTGACGCCAGTTCACATTTGCAAATCGCCCGTCAATCTGTCATTAAACATGTTATCAAATGA
Translation
MPRRKQQAPKRAAG - UNI32122 - GYAQEEVLKEEEEIKEEEEEEEDSGSVAQHQSSNDTGTDEELETGPEQKGYFSCQNSPGSHLSNQDAENESL

LSDASDQVSDVKSVCGRDVSDKKANTHPKLPSEPHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNSSGKNDFDWHQDALSKSLQQNLPSR

SVSKPSLFSSVQLYRQSSKLCGSVFTGASRFRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFCGDSF

DSLQDLSVHMIKTKHYQKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSLADSFSSQKSANLQLPSNSRYGYQNGASYTWQFEACKSQILKCME

CGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLVLDPLAVEKMQSLSETPNSESLAPKPSSNSPSECTASTTELKKESKKEKGEGIEDEQGVKSEDYE

DSLQKPLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSAYPSIHAAYQLSEGTKPPMAMGSQILQIRPNLANKLRPIAPKWKGM

PLGPVPTSLALYTQVKKETEDKDEVVKQCGKESPHEEATSFSQPEGESFSKIEPPSESRKAEPCPLKEEEKPQKEKPEPLEPVSSLTNGCAPANHTPALP

SINPLSALQSVLNNHLGKATEPLRSPSCSSPNSSTSPVFHKSSLHVVDKPVISPTSTRPAASVARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQK

HALCDIADMVKVLPKATTPKPAASSRVPPMKLEIDVRRFEDVSSEVSTLHKRKGRQSNWNPQHLLILQAQFASSLFQTSEGKYLLSDLGPQERMQISKFT

GLSMTTISHWLANVKYQLRKTGGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDMTRMAADQQSKVEQEISRVSSAQRSPETIAGEED

TDSKFKCKLCRRTFVSKHAVKLHLSKTHSKSPEHHSQFVADVDEE - UNI17219 - - UNI17484 - 
Transcript ENSMUST00000109157
Sequence
CTGCGGCCCCCGCGCGCGGCTCGGGGCTGGGGCGCCAGAAGTGAGACTGGAGCTAAGTAGAGCGATGCCAAGGAGGAAACAGCAGGCACCCAAGCGGGCG

GCAG - UNI32122 - GGTATGCCCAGGAGGAAGTCCTGAAGGAAGAGGAGGAAATAAAGGAAGAGGAGGAGGAAGAAGAAGACAGTGGCTCCGTTGC

TCAACACCAGAGCAGCAATGACACTGGGACAGACGAGGAACTAGAAACGGGCCCAGAGCAGAAAGGCTACTTCAGCTGCCAGAACTCACCGGGGAGCCAC

CTGTCCAATCAGGATGCAGAAAACGAGTCTCTCCTGAGCGATGCCAGCGACCAGGTGTCAGACGTCAAAAGTGTCTGTGGCCGAGATGTTTCAGACAAGA

AAGCAAACACTCACCCCAAACTTCCAAGCGAACCCCATAACTGCATGGATAAAATGACAGCTGTCTATGCCAATATCCTGTCAGATTCCTACTGGTCGGG

CCTGGGCCTCGGCTTCAAGTTATCCAACAGTGAGAGACGGAATTGCGACACCCGCAACAGCAGCGGCAAGAATGATTTTGATTGGCACCAAGATGCCCTG

TCCAAAAGCCTGCAGCAGAACTTGCCTTCCCGGTCTGTCTCTAAGCCCAGCCTATTCAGCTCCGTGCAGCTATACCGGCAGAGCAGTAAGTTGTGTGGCT

CGGTGTTCACCGGCGCCAGCAGGTTCCGCTGCAGGCAGTGCAGTGCGGCCTACGACACTCTCGTGGAGCTGACCGTGCACATGAACGAGACAGGCCACTA

TCAAGATGACAACCGCAAAAAAGATAAGCTCAGACCCACGAGCTACTCCAAGCCCCGAAAAAGGGCCTTCCAAGACATGGACAAAGAGGATGCCCAAAAG

GTCCTGAAATGTATGTTTTGTGGTGACTCCTTCGATTCCCTGCAAGATTTGAGTGTCCACATGATAAAGACAAAACATTACCAAAAAGTGCCTTTGAAGG

AGCCGGTACCAACCATTTCCTCCAAGATGGTCACACCAGCCAAGAAGCGTGTTTTCGATGTCAACAGGCCTTGCTCCCCTGACTCCACCACAGGGTCCCT

TGCAGATTCCTTTTCTTCCCAGAAGAGTGCTAACCTGCAGCTGCCCTCCAACAGCCGCTACGGCTACCAAAACGGCGCCAGCTACACCTGGCAGTTCGAG

GCCTGCAAGTCCCAGATCTTAAAGTGTATGGAGTGTGGCAGTTCCCATGATACTTTGCAACAACTCACCACCCACATGATGGTCACAGGCCACTTTCTCA

AAGTCACTAGCTCTGCCTCCAAGAAAGGAAAGCAACTTGTGTTGGACCCCCTAGCTGTGGAGAAAATGCAGTCACTGTCTGAGACCCCAAACAGTGAGTC

TCTGGCCCCTAAGCCATCAAGTAACTCCCCCTCGGAGTGCACAGCCTCTACCACCGAGTTAAAGAAAGAAAGCAAGAAGGAGAAGGGAGAGGGCATTGAA

GACGAACAAGGTGTGAAAAGCGAGGACTACGAAGACTCTCTACAGAAACCTCTCGACCCCACCATAAAATACCAGTACCTAAGAGAGGAGGACTTGGAAG

ACGGCTCGAAGGGTGGTGGGGACATTTTAAAGTCACTGGAAAATACCGTAACCACAGCCATCAACAAGGCCCAGAATGGTGCTCCCAGCTGGAGCGCATA

CCCAAGTATCCACGCAGCCTACCAGCTCTCAGAGGGCACCAAGCCACCTATGGCAATGGGCTCTCAGATACTGCAAATCCGACCCAACCTCGCCAACAAG

CTGAGGCCCATTGCACCCAAATGGAAAGGTATGCCACTCGGCCCTGTCCCCACAAGCCTGGCTCTGTACACTCAAGTCAAGAAGGAGACAGAAGACAAAG

ATGAAGTCGTGAAGCAGTGTGGGAAGGAAAGTCCCCACGAAGAGGCAACATCTTTCAGTCAGCCTGAGGGCGAGTCTTTCTCCAAAATTGAACCACCTTC

AGAATCCAGAAAGGCTGAGCCCTGTCCCCTGAAAGAGGAGGAGAAGCCGCAGAAAGAGAAACCGGAGCCCTTAGAACCAGTATCTTCTCTGACCAATGGC

TGTGCGCCGGCTAACCACACCCCGGCTCTGCCTTCCATCAACCCGCTCAGTGCCCTGCAGTCCGTCCTGAACAACCACCTGGGCAAAGCCACGGAGCCCT

TGCGCTCCCCTTCCTGCTCCAGTCCCAACTCAAGCACAAGCCCCGTGTTCCATAAATCCAGCCTCCACGTGGTGGACAAGCCGGTCATAAGTCCCACCTC

CACCAGGCCGGCGGCCAGCGTGGCCAGACACTACCTGTTTGAGAACACCGACCAGCCCATTGACCTGACCAAGTCCAAAAGCAAGAGAGCCGAGTCCTCG

CAAGCACAATCCTGCACGTCCCCACCTCAGAAGCATGCTCTGTGTGACATTGCTGATATGGTCAAGGTCCTCCCCAAAGCCACCACCCCAAAGCCAGCCG

CCTCCTCGAGGGTCCCTCCTATGAAGCTGGAAATCGACGTCAGACGCTTCGAGGATGTTTCGAGCGAAGTCTCCACTTTGCACAAAAGGAAAGGCCGGCA

GTCCAACTGGAACCCCCAGCATCTTCTCATCCTGCAAGCTCAGTTTGCCTCGAGCCTCTTCCAGACCTCAGAGGGCAAATACCTGCTTTCTGACCTGGGC

CCCCAAGAGCGGATGCAAATCTCCAAGTTCACCGGACTCTCCATGACCACAATCAGCCACTGGCTGGCTAACGTCAAATACCAGCTTAGGAAAACAGGTG

GGACAAAGTTCCTGAAAAACATGGACAAAGGGCACCCCATCTTTTACTGCAGTGACTGTGCGTCCCAGTTCAGAACCCCCTCTACCTACATCAGCCACCT

AGAGTCTCACCTGGGCTTCCAAATGAAGGACATGACCCGGATGGCGGCTGACCAGCAAAGCAAGGTGGAGCAGGAGATCTCCCGAGTGTCGTCGGCTCAG

AGGTCTCCAGAAACAATAGCTGGCGAAGAGGACACAGACTCTAAATTCAAGTGTAAGTTATGCCGTCGGACATTTGTGAGCAAACACGCAGTAAAACTCC

ACCTAAGCAAAACGCACAGCAAGTCACCCGAACACCACTCTCAGTTTGTAGCAGACGTGGATGAAGAATAGTTCTGCAGGTATGGGGTTTGCTCCCAGGT

GACGGTGACCACGGCCTTGTGAGGAGCTTGTTAAAAAGAGATGGGTCTGCTTAGAAGCAGAGGCGTCTCCCGAGGCCTGGCAGGACCTTAGTTTGCTGCC

ATAGACTTAACTTTTACAAAAGACAGGACGGGATGAGTGGCTCCTAGCCATTCCCCCAACATCCTCTAGTTTAGAGGGGAAGCAGGATACAATGTATCTA

AGAGAGATGAAGCTCGTGGTTGTTCCTAGAGCTCCAGGACTCACGGTTCCTTTAGCAACCTAAGGCCCAACCTCCAAGGTCCAACTTCCCCTCATTTTAA

TTAACAAGGACTAGATTCCATTTTGCCATCTGCCTTCCCACAGCAATGCTTAATACTTACCGAGTGGGGAAAGGTGGCACCAGAATGAAGACGGTGGGGG

GAGGGGGACTTCCTAGGGACCGTTATATACAGAGATAGCTTAATCAGTTCACGAATGGCTTAATGATATCTTTACTATCAGCCCTTGCAATGAATCCATT

TGGTAGCTGACTTTTATCGACAGCGCTCCTTCCCTGTTTCCTTCCTACATTCATATCCCTATAGAAGAGCAGGGACCCTTAAGGGGGACTGTCGGGATGC

ACTCTTCTATGGAGCAGGGAGATAAAAATGCCTTTAGATTTTCCTTTAGGATAAACTCGGGATCAGAGTCCACCTTTACCAGATGCAAAACATCCCCGTG

GGTTTATTTCACATACAGAGATGGGTAGTCGAAGGCTGTACACAGCCAAGTGAGTAGGGTCTGTCCAACAGCTTCAAGATGTTATTTTTCAAATTGGGCT

GGAGGTGCACCTTGGTAGTAGAGTTCTTGCCCAGCATACACAAGGTCTTGGGTTCAAGTCCCAGTACCAAAATGAGAAAAGAAAGGAATTTGTACCATGT

ATCATAGAAGTCCACGCCTTGCTTTGTTACCAATGCCCAAAGTTATTTATGTCACCTCCAGGAGAAAGGACAGAGACGACCAAAGGCAAATACTTTATAG

CAAATTAGTCACATGTAGGCTGCTTCCAAATCTTGAGCTTAAGCAAGGCTGGATGCCACCCAAGCTCCTTCATGGGGTTCCTCTGCTTCCTCTTCTCTCC

CCTCCAGCATGGCACGCCCACGCGCTAGGGAGCCCAACACACATCCAGACTGAACTCAAGGGCCCAAACCCGAGCGAAGGGTTCTGTACTTTACAGTCCA

GCACATGCCCCCACAGCGTTACGGAATTGCTCTTAGTTAATTCACGACAAGGTATGGAAAGCTTATCCTAGGAGCCCTCACCACCCACCCCCTCTTCGCA

AAGCTTTTACTTTTACCCAGGAAACTTTCGGGTCAAGCTGCACAGGCACAGGCGCTAAGGGAGTTCCAGATAGAGAAATGTCCTGTGTGACGCGCTCCTA

GCGCTCCTCACAGAGCTAGAGAGCGAGTGGGAAGATGGGCAGAAAGAAAGGGAAATATGTGCTTGACTCGAGACTCTTCCCTCCAGGTGGGAATCCATGC

TTCTGATTTGGGTGGGGCCCCCCCAGAGGGCTACCCCTACTGTTTGCATGCCTTTATCATGATAATTAAATGTTCCGGGCAGATTCACCTCCGGGATTCC

AAGCATGACTGTACATCTTACCTTATTGAATGGAAAGCTATTTTGCATCTGTTGAGCCCAATGTGAGCTCTGGGTTCTGCCACATGCTATTTATTTACCA

TATCACATTTTAAATTTTTATGTAATTAGCCATTATGCTCTTCTGGTCCTTAAAAAAAAAAAGGTGGACATACATAAAGAACCTAGAGACAAGAAGTATG

TTTTAAATCTAATAATTGTGGGTCCAAACCCCGGCGAAGAGAACAAATAGGTGATGTTTATTTTGTGCTATAATAAAGACCAATTTTCCACCTGTTA
Translation
MPRRKQQAPKRAAG - UNI32122 - GYAQEEVLKEEEEIKEEEEEEEDSGSVAQHQSSNDTGTDEELETGPEQKGYFSCQNSPGSHLSNQDAENESL

LSDASDQVSDVKSVCGRDVSDKKANTHPKLPSEPHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNSSGKNDFDWHQDALSKSLQQNLPSR

SVSKPSLFSSVQLYRQSSKLCGSVFTGASRFRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFCGDSF

DSLQDLSVHMIKTKHYQKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSLADSFSSQKSANLQLPSNSRYGYQNGASYTWQFEACKSQILKCME

CGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLVLDPLAVEKMQSLSETPNSESLAPKPSSNSPSECTASTTELKKESKKEKGEGIEDEQGVKSEDYE

DSLQKPLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSAYPSIHAAYQLSEGTKPPMAMGSQILQIRPNLANKLRPIAPKWKGM

PLGPVPTSLALYTQVKKETEDKDEVVKQCGKESPHEEATSFSQPEGESFSKIEPPSESRKAEPCPLKEEEKPQKEKPEPLEPVSSLTNGCAPANHTPALP

SINPLSALQSVLNNHLGKATEPLRSPSCSSPNSSTSPVFHKSSLHVVDKPVISPTSTRPAASVARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQK

HALCDIADMVKVLPKATTPKPAASSRVPPMKLEIDVRRFEDVSSEVSTLHKRKGRQSNWNPQHLLILQAQFASSLFQTSEGKYLLSDLGPQERMQISKFT

GLSMTTISHWLANVKYQLRKTGGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDMTRMAADQQSKVEQEISRVSSAQRSPETIAGEED

TDSKFKCKLCRRTFVSKHAVKLHLSKTHSKSPEHHSQFVADVDEE
Transcript ENSMUST00000099062
Sequence
GAGGAGGAGAAGGAGGAGAAGGAGAAGGAGGAGAAGGAGGAGGTGGTAAAGGAAGAGGAGGTGGAGGAAGAGGAGGAAGAAGAGGAGGAGGGAAAGAGAA

GGAAGAAGAAAAAGAAGAAATCCACTGTCTTCCCGGGATTGTTTCCCCCCTTATCTTTAAGCGCGAGTGTGCGCGTGGCGCGTGTGCGCCCCTCATCCCT

GCCATCTGAACCCCGTCTTGGATGTTTAATAAAGAAATCAAGTGTCTCACCAGTCACCAAAAAAACAGCAAAAAGCAAAACCAAAAAAAGAAAAAAATCC

AAAAGCAAAACAAAAAGAGAGGGGGAAAAAAAACCAAACAAACAAACAAGGCAGAACCAACCTCCACTTGCAAGCAGCAGGCGCGAGCCACATATCTGCC

ACCCAGAGAGGGGGTCTCCGGCCCCGCGCTGGAGCGCTGGCAGGGGGATCTTCAGGGGGACAGAGGCCGAGTGACGTCCTAGGAGCCACAGAAAGACGAG

CGAGACTGCGGCCCCCGCGCGCGGCTCGGGGCTGGGGCGCCAGAAGTGAGACTGGAGCTAAGTAGAGCGATGCCAA - UNI32122 - GGAGGAAACT

GGAACAGGAAACC CTGTCTCCTGCAGGGTATGCCCAGGAGGAAGTCCTGAAGGAAGAGGAGGAAATAAAGGAAGAGGAGGAGGAAGAAGAAGACAGTGG

CTCCGTTGCTCAACACCAGAGCAGCAATGACACTGGGACAGACGAGGAACTAGAAACGGGCCCAGAGCAGAAAGGCTACTTCAGCTGCCAGAACTCACCG

GGGAGCCACCTGTCCAATCAGGATGCAGAAAACGAGTCTCTCCTGAGCGATGCCAGCGACCAGGTGTCAGACGTCAAAAGTGTCTGTGGCCGAGATGTTT

CAGACAAGAAAGCAAACACTCACCCCAAACTTCCAAGCGAACCCCATAACTGCATGGATAAAATGACAGCTGTCTATGCCAATATCCTGTCAGATTCCTA

CTGGTCGGGCCTGGGCCTCGGCTTCAAGTTATCCAACAGTGAGAGACGGAATTGCGACACCCGCAACAGCAGCGGCAAGAATGATTTTGATTGGCACCAA

GATGCCCTGTCCAAAAGCCTGCAGCAGAACTTGCCTTCCCGGTCTGTCTCTAAGCCCAGCCTATTCAGCTCCGTGCAGCTATACCGGCAGAGCAGTAAGT

TGTGTGGCTCGGTGTTCACCGGCGCCAGCAGGTTCCGCTGCAGGCAGTGCAGTGCGGCCTACGACACTCTCGTGGAGCTGACCGTGCACATGAACGAGAC

AGGCCACTATCAAGATGACAACCGCAAAAAAGATAAGCTCAGACCCACGAGCTACTCCAAGCCCCGAAAAAGGGCCTTCCAAGACATGGACAAAGAGGAT

GCCCAAAAGGTCCTGAAATGTATGTTTTGTGGTGACTCCTTCGATTCCCTGCAAGATTTGAGTGTCCACATGATAAAGACAAAACATTACCAAAAAGTGC

CTTTGAAGGAGCCGGTACCAACCATTTCCTCCAAGATGGTCACACCAGCCAAGAAGCGTGTTTTCGATGTCAACAGGCCTTGCTCCCCTGACTCCACCAC

AGGGTCCCTTGCAGATTCCTTTTCTTCCCAGAAGAGTGCTAACCTGCAGCTGCCCTCCAACAGCCGCTACGGCTACCAAAACGGCGCCAGCTACACCTGG

CAGTTCGAGGCCTGCAAGTCCCAGATCTTAAAGTGTATGGAGTGTGGCAGTTCCCATGATACTTTGCAACAACTCACCACCCACATGATGGTCACAGGCC

ACTTTCTCAAAGTCACTAGCTCTGCCTCCAAGAAAGGAAAGCAACTTGTGTTGGACCCCCTAGCTGTGGAGAAAATGCAGTCACTGTCTGAGACCCCAAA

CAGTGAGTCTCTGGCCCCTAAGCCATCAAGTAACTCCCCCTCGGAGTGCACAGCCTCTACCACCGAGTTAAAGAAAGAAAGCAAGAAGGAGAAGGGAGAG

GGCATTGAAGACGAACAAGGTGTGAAAAGCGAGGACTACGAAGACTCTCTACAGAAACCTCTCGACCCCACCATAAAATACCAGTACCTAAGAGAGGAGG

ACTTGGAAGACGGCTCGAAGGGTGGTGGGGACATTTTAAAGTCACTGGAAAATACCGTAACCACAGCCATCAACAAGGCCCAGAATGGTGCTCCCAGCTG

GAGCGCATACCCAAGTATCCACGCAGCCTACCAGCTCTCAGAGGGCACCAAGCCACCTATGGCAATGGGCTCTCAGATACTGCAAATCCGACCCAACCTC

GCCAACAAGCTGAGGCCCATTGCACCCAAATGGAAAGGTATGCCACTCGGCCCTGTCCCCACAAGCCTGGCTCTGTACACTCAAGTCAAGAAGGAGACAG

AAGACAAAGATGAAGTCGTGAAGCAGTGTGGGAAGGAAAGTCCCCACGAAGAGGCAACATCTTTCAGTCAGCCTGAGGGCGAGTCTTTCTCCAAAATTGA

ACCACCTTCAGAATCCAGAAAGGCTGAGCCCTGTCCCCTGAAAGAGGAGGAGAAGCCGCAGAAAGAGAAACCGGAGCCCTTAGAACCAGTATCTTCTCTG

ACCAATGGCTGTGCGCCGGCTAACCACACCCCGGCTCTGCCTTCCATCAACCCGCTCAGTGCCCTGCAGTCCGTCCTGAACAACCACCTGGGCAAAGCCA

CGGAGCCCTTGCGCTCCCCTTCCTGCTCCAGTCCCAACTCAAGCACAAGCCCCGTGTTCCATAAATCCAGCCTCCACGTGGTGGACAAGCCGGTCATAAG

TCCCACCTCCACCAGGCCGGCGGCCAGCGTGGCCAGACACTACCTGTTTGAGAACACCGACCAGCCCATTGACCTGACCAAGTCCAAAAGCAAGAGAGCC

GAGTCCTCGCAAGCACAATCCTGCACGTCCCCACCTCAGAAGCATGCTCTGTGTGACATTGCTGATATGGTCAAGGTCCTCCCCAAAGCCACCACCCCAA

AGCCAGCCGCCTCCTCGAGGGTCCCTCCTATGAAGCTGGAAATCGACGTCAGACGCTTCGAGGATGTTTCGAGCGAAGTCTCCACTTTGCACAAAAGGAA

AGGCCGGCAGTCCAACTGGAACCCCCAGCATCTTCTCATCCTGCAAGCTCAGTTTGCCTCGAGCCTCTTCCAGACCTCAGAGGGCAAATACCTGCTTTCT

GACCTGGGCCCCCAAGAGCGGATGCAAATCTCCAAGTTCACCGGACTCTCCATGACCACAATCAGCCACTGGCTGGCTAACGTCAAATACCAGCTTAGGA

AAACAGGTGGGACAAAGTTCCTGAAAAACATGGACAAAGGGCACCCCATCTTTTACTGCAGTGACTGTGCGTCCCAGTTCAGAACCCCCTCTACCTACAT

CAGCCACCTAGAGTCTCACCTGGGCTTCCAAATGAAGGACATGACCCGGATGGCGGCTGACCAGCAAAGCAAGGTGGAGCAGGAGATCTCCCGAGTGTCG

TCGGCTCAGAGGTCTCCAGAAACAATAGCTGGCGAAGAGGACACAGACTCTAAATTCAAGTGTAAGTTATGCCGTCGGACATTTGTGAGCAAACACGCAG

TAAAACTCCACCTAAGCAAAACGCACAGCAAGTCACCCGAACACCACTCTCAGTTTGTAGCAGACGTGGATGAAGAATAGTTCTGCAG - UNI17219 

- - UNI17484 - AGTTCTACAGCCTCCAACACGAGACTGAAAGCCAGGCTGCGGTGGATGGACCAGGATGCTGCGGGTTGACCAGACTGCTGCGGGT

GGACCAGGCTGCTGCGGGTGGACCAGGCTGCTGCGGGTGGACCAGGCTGCTGCGGGTGGACCAGGCTGCTGCGGGTGGGCCTCGCTGCAGTTGCTGCGGA

TGGATCTGATGCCTGTTAAGCATCACTTCTCCAGTGTGAGCCCGCCACCTCCATTTCCGTCACGTGTGCCCATCTTTTTCAGTCTAATGAACTCCAACCA

TCAGCGCAACTTAAGTTCGGCTGTCTGTTCGTGCATGCTTAATATTAAAAATGTACTAACAGTGTGGCTGAGAAATCAAATTATGCACATAAATATGCTG

GCATAGCAGAGGCGGCGGCAGAAGCTGAACTTAGCAGAGCTGACGCCAGTTCACATTTGCAAATCGCCCGTCAATCTGTCATTAAACATGTTATCAAATG

AT
Translation
 - UNI32122 -  MPLGPVPTSLALYTQVKKETEDKDEVVKQCGKESPHEEATSFSQPEGESFSKIEPPSESRKAEPCPLKEEEKPQKEKPEPLEPVS

SLTNGCAPANHTPALPSINPLSALQSVLNNHLGKATEPLRSPSCSSPNSSTSPVFHKSSLHVVDKPVISPTSTRPAASVARHYLFENTDQPIDLTKSKSK

RAESSQAQSCTSPPQKHALCDIADMVKVLPKATTPKPAASSRVPPMKLEIDVRRFEDVSSEVSTLHKRKGRQSNWNPQHLLILQAQFASSLFQTSEGKYL

LSDLGPQERMQISKFTGLSMTTISHWLANVKYQLRKTGGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDMTRMAADQQSKVEQEISR

VSSAQRSPETIAGEEDTDSKFKCKLCRRTFVSKHAVKLHLSKTHSKSPEHHSQFVADVDEE - UNI17219 - - UNI17484 - 

For any suggestions or comments, please send an email to unitrap@crg.es