Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048000 (Gigyf2)
Chromosomal location
Chr 1: 89223617 - 89347347 (+)
Description
GRB10 interacting GYF protein 2 Gene [Source:MGI Symbol;Acc:MGI:2138584]
RefSeq_dna
NM_146112 
RefSeq_peptide
NP_666224.3 NP_001103682.1 
UniGene
Mm.413309 Mm.23065 
MGI
MGI:2138584 
Uniprot/SWISSPROT
Q6Y7W8 
Uniprot/SPTREMBL
Q3TUA5 Q8C585 
Human Ortholog
ENSG00000204120 (GIGYF2)
Omim 607688 - PARKINSON DISEASE 11  
UniTrap UNI10432
Vector Insertion
Chr 1: 89223668 - 89230844
Public Clones 5SD065B12 (ggtc) D044B07 (ggtc) 3SP134D02 (ggtc) D089E05 (ggtc)
(ggtc) 5SD041H10 (ggtc) D014A09 (ggtc) 5SP094F04 (ggtc) D065B12 (ggtc)
3SD041H10 (ggtc) P088F10 (ggtc) 3SP094F04 (ggtc) CMHD-GT_264G02-3 (cmhd)
Private Clones OST453083 (lexicon) OST346678 (lexicon) OST283522 (lexicon) OST270943 (lexicon)
OST262912 (lexicon) OST223639 (lexicon) OST194045 (lexicon) OST146959 (lexicon)
OST143855 (lexicon) OST122648 (lexicon) OST43067 (lexicon) OST38222 (lexicon)
OST38221 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10722
Vector Insertion
Chr 1: 89230910 - 89250978
Public Clones (sanger) 5SD142D08 (ggtc) D033B10 (ggtc) 3SD036H03 (ggtc) 3SD168C05 (ggtc)
3SD142D08 (ggtc) D036H03 (ggtc) 5SD033B10 (ggtc) E115G10 (ggtc)
3SH002E04 (ggtc) H002E04 (ggtc) 5SD036H03 (ggtc) P016C04 (ggtc)
5SD168C05 (ggtc) CMHD-GT_430H12-3 (cmhd) PST4644-NL (escells) IST14658D8 (tigm)
IST12179B9 (tigm)
Private Clones OST466117 (lexicon) OST372304 (lexicon) OST98348 (lexicon) OST69805 (lexicon)
OST39583 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26564
Vector Insertion
Chr 1: 89251062 - 89260678
Public Clones not available
Private Clones OST110857 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12202
Vector Insertion
Chr 1: 89260809 - 89261758
Public Clones A032B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2704
Vector Insertion
Chr 1: 89261855 - 89270571
Public Clones XR0051 (sanger) AL0164 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI156
Vector Insertion
Chr 1: 89270687 - 89275546
Public Clones GC0143 (tigem) XH076 (baygenomics) RRB002 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10825
Vector Insertion
Chr 1: 89275659 - 89276542
Public Clones 3SD009F07 (ggtc) D009F07 (ggtc) 3SP147E09 (ggtc) G026G09 (ggtc)
5SD009F07 (ggtc) P147E09 (ggtc) 5SP147E09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8789
Vector Insertion
Chr 1: 89276584 - 89300241
Public Clones TEA073 (baygenomics) XC223 (baygenomics) TEA013 (baygenomics) A024F07 (ggtc)
A062E03 (ggtc) PST1188 (escells) PST2476-NL (escells) PST10923-NR (escells)
PST3190-NR (escells) PST5245-NL (escells) PST5245-NR (escells) IST14979E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15234
Vector Insertion
Chr 1: 89308443 - 89313392
Public Clones PST11129-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3490
Vector Insertion
Chr 1: 89330254 - 89330492
Public Clones AB0020 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2581
Vector Insertion
Chr 1: 89333467 - 89336962
Public Clones XS0857 (sanger) XS0153 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097662
Sequence
TGAGGCTGAGGATTGACTTGGGTTCTGAGAGACTCCTGTCCCGGACCGCAG - UNI10432 - TGTTAAAAAGACCTGAACACATTTGCTGAAACCTC

TTGCTGTGAGATAGCAGAACTTTTGAGCAG - UNI10722 - GTTTCTCTACACATAAAAATCTTTTCAAAAATACGGAGAAGAATGGCAGCAGAAAC

ACAGACACTAAACTTTGGGCCTGAATG - UNI26564 - GCTCCGTGCTCTGTCCAGTGGTGGGAGTATCACGTCCCCTCCTCTTTCTCCGGCCCTGC

CAAAGTATAAATTAGCAGATTATCGATATGGCCGAGAAGAAATGTTAGCACTTTTCCTTAAAGACTACAAG - UNI12202 - ATACCCTTTGATCTT

CTGGAGAAAGAATTCCTGCCTATCCTACAGGAGGAGCCCTTGCCACCATTGGCTCTAGTACCCTTTACAGAAGAAGAGCAG - UNI2704 - AGAAAC

TTTTCCATGTCTGTAAATAGTGCCGCTGTCCTGCGATTGACAGGACGAGGAGGAGGAGGAGGAACAGTGGTGGGGGCTCCTAGAGGTCGAAGTTCTTCAA

GAGGGCGAG - UNI156 - - UNI8789 - - UNI10825 - GGAGACCAAATTTTGAGGAAAGTGGACCAACGTCTGTGGGGAGAAAGCATGAAT

TTATACGGTCAGAAAGTGAAAACTGGCGAATCTTTAGAGAGGAACAGAATGGAGAAGATGAAGATGGAGGTTGGCGGTTAGCTGGATCAAGAAGGGATGG

AGAGAGATGGCGGCCTCACAGTCCTG GCTGGCGGGAACACATGGAACGCCGTCGGAGGTTTGAGTTTGATTTTCGAGACCGAGATGATGAGCGTGGTTA

CCGAAGGGTGCGCTCTGGCAGTGGGAGCATAGATGACGACAGGGATAGCTTGCCGGAGTGGTGCTTAGAGGATGCTGAGGAAGAAATGGGCACGTTTGAC

TCTTCTGGGGCATTCCTCTCTCTAAAA AAAGTGCAGAAAGAACCTATTCCTGAAGAGCAGGAAATGGACTTTAGGCCTGTGGAGGAGGGAGAGGAGCGC

TCTGACTCTGACAGCAGCCATAACGAAGAGGCCAAAGAACCGGATAAGACAAACCGAAGAGAGGGGGAGAAAACAGACAGAGCAGGGGCTG AAGCTAGT

GAGGAAGTACCTCAGACGTCATTGTCATCTGCTAGACCAGGTACCCCTTCAGATCATCAGCCTCAAGAAGCCACACAGTTTGAGAGGAAAGATGAACCCA

AAGCTGAACAAGTGGAAAAGGCTGAAGAAGAGAATCGGTCAGAAAATAGTCTCTCAGCCAAGGTCCCCAGCAGAGGGGATG AAACGGTGCCTGCCTCCC

AGCAACCCTCCACACCGCTTCCTCCAGACACAGCCTCTCCTCTCCTCATCCTGTCGCCTCCTGTTCCTACTCCTAGTTCTGCCTCTCGGCCAGTTGAGAC

AGCAGCCGTCGAAGCTCCTGGTATGAGCAGTGTTTCCACAGAGCCAGATGATGAAGAGGGCCTCAAACACTTGGAACAG CAAGCTGAGAAGATGGTGGC

TTATCTCCAAGACAGTGCACTAGACGACGAAAGATTGACATCAAAACTGCAAGAGCACCGAGCTAAAGGAGTGTCAATCCCACTGATGCATGAAGCAATG

CAGAAGTGGTATTACAAAGACCCTCAGGGGGAGATTCAAG - UNI15234 - GTCCCTTTAACAATCAGGAGATGGCCGAGTGGTTTCAGGCGGGCTA

TTTTACTATGTCTTTGCTGGTGAAGAGAGCATGTGATGAAAGCTTCCAGCCCCTTGGTGATATCATGAAAATGTGGGGAAGGGTTCCTTTCTCTCCAGGC

CCAGCTCCCCCTCCTCATATG GGAGAATTGGACCAGGAACGCCTGACCAGACAGCAGGAACTCACTGCCTTATACCAGATGCAGCACCTCCAGTACCAG

CAGTTCTTAATCCA ACAACAGTATGCACAGGTTTTGGCTCAACAGCAGAAAGCAGCTTTGTCATCTCAGCAGCAACAACAATTGGCTCTTCTTCTGCAG

CAGTTCCAGGCTCTGAAGATGAG AATGTCTGATCAGAACATCATTCCCTCAGTAACTAGGTCTGTGTCAGTGCCAGATACTGGCTCTATCTGGGAGCTT

CAGCCAGCAGCCTCACAGCCTGCAG TTTGGGAAGGTGGTAGTGTATGGGATCTTCCCCTGGACACCACAGCACCAGGTCCTTCCCTGGAACAGCTTCAG

CAGCTAGAGAAGGCCAAAGCTGCAAAG TTAGAACAGGAGAGAAGAGAGGCAGAAATGAGGGCAAAAAGGGAAGAGGAGGAGCGAAAGAGGCAAGAAGAA

CTCCGAAGACAACAGGAGGAAATCCTTCGGAGGCAGCAGGAGGAAGAAAGGAAAAGACGGGAAGAAGAGGAACTTGCTCGAAGGAAGCAG GAGGAGGCT

CTGCGGCGCCAACGGGAGCAAGAGATTGCGCTAAGGCGGCAGCGAGAAGAGGAGGAAAGACAGCAGCAGGAAGAAGCTCTTAGACGATTGGAGGAGCGGA

GGAGAGAAGAGGAGGAAAGGCGGAAGCAGGAAGAACTGCTGCGCAAGCAG - UNI3490 - GAAGAGGAGGCTGCCAAATGGGCCCGGGAAGAGGAAG

AAGCCCAGCGCCGACTGGAAGAGAACCGGCTGCGCATGGAGGAGGAGGCTGCCAGACTTCGGCATGAAGAAGAAGAAAGAAAACGGAAGGAATTGGAGCT

GCAGAGGCAGAAGGATCTGATGCGTCAGAGACAGCAGCAGCAAGAGGCTCTCCGAAGGCTGCAGCAGCAACAGCAGCAGCAACAGCTTGCACAAATGAAG

 - UNI3490 - CTTCCCTCTTCGTCAACGTGGGGTCAGCAGTCTAACACAGCAACATGTCAGTCCCAGGCCACGCTGTCATTGGCTGAGATCCAGAAG

CTGGAAGAAGAACGAGAACGCCAGCTTCGTGAAGAG - UNI2581 - CAAAGACGTCAGCAGAGGGAATTGATGAAAGCTCTCCAGCAGCAGCAGCAG

CAGCAGCAACAACAAAAACTCTCAGGTTGGGGGAATGTCAGCAAACCTGCAGGTACCACCAAGTCTCTACTAGAGATCCAGCAGGAAGAGGCCAGGCAGA

TGCAGAAGCAGCAGCAGCAGCAACAACAACAACAACAGCAACACCAGCAATCAAACAGAGCCCGGAACAGCACA CATTCCAACCTGCATACCAGCCTTG

GGAATTCTGTATGGGGCTCTATAAACACAGGTCCTTCTAACCAGTGGGCGTCTGAGCTAGTCAGTAGTATCTGGAGTAATGCAGACACCAAAAACTCCAA

CATGGGGTTTTGGGATGATGCAGTGAAAGAGGTGGGACCTAGAAATTCAACAAATAAAAATAAAAACAACGCCAGTCTCAG TAAATCTGTAGGTGTGTC

TAACCGGCAGAATAAGAAAGTAGAAGAAGAAGAAAAGTTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACCCAGTGGTGTGAACAG

ATGCTTCATGCCCTTAATACGGCAAATAACTTGGATG TTCCCACGTTTGTTTCTTTCTTGAAAGAAGTGGAGTCTCCTTATGAAGTCCATGACTATACC

AGGGCCTATTTAGGAGATACTTCCGAGGCCAAGGAGTTTGCCAAGCAGTTCCTTGAACGCCGTGCCAAACAGAAAGTCAACCAGCAGCGTCAGCAGCAGC

AGCAGCAGCAGCAGCAGCAG GACTCTGTCTGGGGGATGAACCATAGTACACTCCATTCGGTATTTCAGACCAATCAAAGCAACAACCAACAATCAAATT

TTGAGGCTGTGCAAAGTGGCAAGAAGAAGAAAAAGCAGAAGATGGTTCGAGCAGATCCCAGTTTATTAG GGTTTTCAGTCAACGCCTCGTCAGAGCGAC

TGAACATGGGTGAGATTGAGACTCTGGATGACTACTGAGTTCCTGCCGCTGTGCCAGCCTTCCCACTCCCGCCTAGTGACCATGGTTTCTCCTCATTGGA

CACAACATACGTTCACCATTTTCTCTGTCACTCTGCAACAAATCACAGAACCAATCATCTCAGGCTTTTTTTTTTCCTAGCCCTTTGTGTCCAAGATTAC

TTTAGATCACTGTTGGTGAGCATCTCAGACTGTACCTAGTGGACCAGCCCTTGTCTCAGGGTGGCAGTTGGGGCTGCTCCCCAGCAGAGCTAATGTTGCC

AGCACACATTCACTGTGCGTTGATTTCATCTACTGTCTCCTGGAAGTGTGTTGGAATCTGCCAATAGCAGATCACTTTCTCTTATCACTTTTCTTGTTCT

GTTTTGTTCTTTCTCCCCACCCCTCTATTCCACCCCATACCGGCAAAGGGCCTTAACTGGTGCAGTCATGAAGAGAGTTAATGGTTAATAGACATTGGCC

AGCAACAAATCACCCCCTGGACAGTAACTTCTCTATTGCCACAGGCAGGCATAACTCTGTCTGTAGGTTGCATGACCATTGTTAACGTGGGGATTGCATC

AGAGGCCTGAGAGGGGTGTAGATTGGCTTGTTTGATGTTGCACACCCTCGCTGTTCTTTCTGAAGAAAGGATGCGTGTGTTCTTCATTAGATAGTAACTT

TCTAAGCAAGCTGTGTTCTCCCTAACATATTCCAACGTTACTACTGGACAAAAGAAACCCTATGGCCTGGGACAGGGACTTAATTTTCCTTTCATATAAA

AACTGATCTCCCCTCCTCCCATAAATATTTTTACTTCAAGGACTAGGACCAGTTTGTTTTGGGCCCTTATGTGAAAATTTGTCTCGTTTAAGAGGCATCT

TTACCATATGTATGAATTTGTGTAATTTCAACTCGGATAGGGATAAACTTTTGCTTCTGATAAAAGCTGGGAATTTCATCTGTTCCTCAGAGCACCGTGT

GCATGTTTTGCCATGGCCCTGAAAAGGTCTTGTGAAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACAAAGCCTGACCATCT

TTAAGACCTTCATCCGTGGAAACCACTATGCAGGAGGATGCAATGGGGTATGGGGATGGCAGGCACAGGAGTGGGAGGCCTGCTCCATAGCAAGGCCAAG

TGTACTCAAGCTCTGTACAGACAGACTCTGACTGCTTCTGCTCCTCGCCTAGTGAACATCACCTGGGATAGTCGAACACCTCGGCGGCAGCTGTGGGTCA

GCTGGGCCTGTGCAAGAGGTGCTGTGGTGGGCAGCTCGGCATCTGTGCCTGGACAAGGCTGGAGTTGCTCTCAGAGCAGTTTGGTATTGGAAGATTATAT

TTGGTTTCTATTTTTATTATTTTGCATCACCATTCTCCCTATCCTTTCTTGCCTCTCTCCCTCCTAAATGTGTACAATAACTATACAGAGACTGCTACAA

ACTTGTAAATAGTTTTTGGATCAAATAGCATAAGGAGATAGGAACCATTAAAATGTGAGACTCCTCTCCTTTGCTTTGTAAATTCAAAAGGGGGGGTGGG

GAAGAGGGATAGTTAAAATGTTTACAAAACTTTAAGCTCCCTCGGAACTTTTGCCAGTGTGGAGG
Translation
 - UNI10432 -  - UNI10722 - MAAETQTLNFGPEW - UNI26564 - WLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDYK

 - UNI12202 - IPFDLLEKEFLPILQEEPLPPLALVPFTEEEQ - UNI2704 - RNFSMSVNSAAVLRLTGRGGGGGTVVGAPRGRSSSRGRG -

 UNI156 - - UNI8789 - - UNI10825 - GRPNFEESGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPG GWR

EHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTFDSSGAFLSLK KVQKEPIPEEQEMDFRPVEEGEERSDSDSSHNEEA

KEPDKTNRREGEKTDRAGAE EASEEVPQTSLSSARPGTPSDHQPQEATQFERKDEPKAEQVEKAEEENRSENSLSAKVPSRGDE ETVPASQQPSTPLP

PDTASPLLILSPPVPTPSSASRPVETAAVEAPGMSSVSTEPDDEEGLKHLEQ QAEKMVAYLQDSALDDERLTSKLQEHRAKGVSIPLMHEAMQKWYYKD

PQGEIQG - UNI15234 - GPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHM GELDQERLTRQQELTALYQMQH

LQYQQFLIQ QQQYAQVLAQQQKAALSSQQQQQLALLLQQFQALKMR RMSDQNIIPSVTRSVSVPDTGSIWELQPAASQPAV VWEGGSVWDLPLDTTA

PGPSLEQLQQLEKAKAAK LEQERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEER  - UNI3490 -  - UNI3490 -  - UNI2581 - 

     
Transcript ENSMUST00000027475
Sequence
TGAGGCTGAGGATTGACTTGGGTTCTGAGAGACTCCTGTCCCGGACCGCAG - UNI10432 - TGTTAAAAAGACCTGAACACATTTGCTGAAACCTC

TTGCTGTGAGATAGCAGAACTTTTGAGCAG - UNI10722 - GTTTCTCTACACATAAAAATCTTTTCAAAAATACGGAGAAGAATGGCAGCAGAAAC

ACAGACACTAAACTTTGGGCCTGAATG - UNI26564 - GCTCCGTGCTCTGTCCAGTGGTGGGAGTATCACGTCCCCTCCTCTTTCTCCGGCCCTGC

CAAAGTATAAATTAGCAGATTATCGATATGGCCGAGAAGAAATGTTAGCACTTTTCCTTAAAGACTACAAG - UNI12202 - ATACCCTTTGATCTT

CTGGAGAAAGAATTCCTGCCTATCCTACAGGAGGAGCCCTTGCCACCATTGGCTCTAGTACCCTTTACAGAAGAAGAGCAG - UNI2704 - AGAAAC

TTTTCCATGTCTGTAAATAGTGCCGCTGTCCTGCGATTGACAGGACGAGGAGGAGGAGGAGGAACAGTGGTGGGGGCTCCTAGAGGTCGAAGTTCTTCAA

GAGGGCGAG - UNI156 - GCAGAGGTAGAGGTGAATGTGGTTTCTACCAAAGAAGTTTTGATGAAGTAGAGGGTGTGTTTGGGCGAGGAGGTGGCAG

GGAAATGCATAGATCACAGAGCTGGGAAGAAAG - UNI10825 - GGGTGACAGGCGCTTTGAAAAACCAGGAAGAAAAGATGTAG - UNI8789 -

 GGAGACCAAATTTTGAGGAAAGTGGACCAACGTCTGTGGGGAGAAAGCATGAATTTATACGGTCAGAAAGTGAAAACTGGCGAATCTTTAGAGAGGAAC

AGAATGGAGAAGATGAAGATGGAGGTTGGCGGTTAGCTGGATCAAGAAGGGATGGAGAGAGATGGCGGCCTCACAGTCCTG ATGGCCCTCGTTCTACAG

GCTGGCGGGAACACATGGAACGCCGTCGGAGGTTTGAGTTTGATTTTCGAGACCGAGATGATGAGCGTGGTTACCGAAGGGTGCGCTCTGGCAGTGGGAG

CATAGATGACGACAGGGATAGCTTGCCGGAGTGGTGCTTAGAGGATGCTGAGGAAGAAATGGGCACGTTTGACTCTTCTGGGGCATTCCTCTCTCTAAAA

 AAAGTGCAGAAAGAACCTATTCCTGAAGAGCAGGAAATGGACTTTAGGCCTGTGGAGGAGGGAGAGGAGCGCTCTGACTCTGACAGCAGCCATAACGAA

GAGGCCAAAGAACCGGATAAGACAAACCGAAGAGAGGGGGAGAAAACAGACAGAGCAGGGGCTG AAGCTAGTGAGGAAGTACCTCAGACGTCATTGTCA

TCTGCTAGACCAGGTACCCCTTCAGATCATCAGCCTCAAGAAGCCACACAGTTTGAGAGGAAAGATGAACCCAAAGCTGAACAAGTGGAAAAGGCTGAAG

AAGAGAATCGGTCAGAAAATAGTCTCTCAGCCAAGGTCCCCAGCAGAGGGGATG AAACGGTGCCTGCCTCCCAGCAACCCTCCACACCGCTTCCTCCAG

ACACAGCCTCTCCTCTCCTCATCCTGTCGCCTCCTGTTCCTACTCCTAGTTCTGCCTCTCGGCCAGTTGAGACAGCAGCCGTCGAAGCTCCTGGTATGAG

CAGTGTTTCCACAGAGCCAGATGATGAAGAGGGCCTCAAACACTTGGAACAG CAAGCTGAGAAGATGGTGGCTTATCTCCAAGACAGTGCACTAGACGA

CGAAAGATTGACATCAAAACTGCAAGAGCACCGAGCTAAAGGAGTGTCAATCCCACTGATGCATGAAGCAATGCAGAAGTGGTATTACAAAGACCCTCAG

GGGGAGATTCAAG - UNI15234 - GTCCCTTTAACAATCAGGAGATGGCCGAGTGGTTTCAGGCGGGCTATTTTACTATGTCTTTGCTGGTGAAGAG

AGCATGTGATGAAAGCTTCCAGCCCCTTGGTGATATCATGAAAATGTGGGGAAGGGTTCCTTTCTCTCCAGGCCCAGCTCCCCCTCCTCATATG GGAGA

ATTGGACCAGGAACGCCTGACCAGACAGCAGGAACTCACTGCCTTATACCAGATGCAGCACCTCCAGTACCAGCAGTTCTTAATCCA ACAACAGTATGC

ACAGGTTTTGGCTCAACAGCAGAAAGCAGCTTTGTCATCTCAGCAGCAACAACAATTGGCTCTTCTTCTGCAGCAGTTCCAGGCTCTGAAGATGAG AAT

GTCTGATCAGAACATCATTCCCTCAGTAACTAGGTCTGTGTCAGTGCCAGATACTGGCTCTATCTGGGAGCTTCAGCCAGCAGCCTCACAGCCTGCAG T

TTGGGAAGGTGGTAGTGTATGGGATCTTCCCCTGGACACCACAGCACCAGGTCCTTCCCTGGAACAGCTTCAGCAGCTAGAGAAGGCCAAAGCTGCAAAG

 TTAGAACAGGAGAGAAGAGAGGCAGAAATGAGGGCAAAAAGGGAAGAGGAGGAGCGAAAGAGGCAAGAAGAACTCCGAAGACAACAGGAGGAAATCCTT

CGGAGGCAGCAGGAGGAAGAAAGGAAAAGACGGGAAGAAGAGGAACTTGCTCGAAGGAAGCAG GAGGAGGCTCTGCGGCGCCAACGGGAGCAAGAGATT

GCGCTAAGGCGGCAGCGAGAAGAGGAGGAAAGACAGCAGCAGGAAGAAGCTCTTAGACGATTGGAGGAGCGGAGGAGAGAAGAGGAGGAAAGGCGGAAGC

AGGAAGAACTGCTGCGCAAGCAG - UNI3490 - GAAGAGGAGGCTGCCAAATGGGCCCGGGAAGAGGAAGAAGCCCAGCGCCGACTGGAAGAGAACC

GGCTGCGCATGGAGGAGGAGGCTGCCAGACTTCGGCATGAAGAAGAAGAAAGAAAACGGAAGGAATTGGAGCTGCAGAGGCAGAAGGATCTGATGCGTCA

GAGACAGCAGCAGCAAGAGGCTCTCCGAAGGCTGCAGCAGCAACAGCAGCAGCAACAGCTTGCACAAATGAAG - UNI3490 - CTTCCCTCTTCGTC

AACGTGGGGTCAGCAGTCTAACACAGCAACATGTCAGTCCCAGGCCACGCTGTCATTGGCTGAGATCCAGAAGCTGGAAGAAGAACGAGAACGCCAGCTT

CGTGAAGAG - UNI2581 - CAAAGACGTCAGCAGAGGGAATTGATGAAAGCTCTCCAGCAGCAGCAGCAGCAGCAGCAACAACAAAAACTCTCAGGT

TGGGGGAATGTCAGCAAACCTGCAGGTACCACCAAGTCTCTACTAGAGATCCAGCAGGAAGAGGCCAGGCAGATGCAGAAGCAGCAGCAGCAGCAACAAC

AACAACAACAGCAACACCAGCAATCAAACAGAGCCCGGAACAGCACA CATTCCAACCTGCATACCAGCCTTGGGAATTCTGTATGGGGCTCTATAAACA

CAGGTCCTTCTAACCAGTGGGCGTCTGAGCTAGTCAGTAGTATCTGGAGTAATGCAGACACCAAAAACTCCAACATGGGGTTTTGGGATGATGCAGTGAA

AGAGGTGGGACCTAGAAATTCAACAAATAAAAATAAAAACAACGCCAGTCTCAG TAAATCTGTAGGTGTGTCTAACCGGCAGAATAAGAAAGTAGAAGA

AGAAGAAAAGTTGCTGAAGCTCTTTCAGGGAGTAAATAAAGCCCAAGATGGATTTACCCAGTGGTGTGAACAGATGCTTCATGCCCTTAATACGGCAAAT

AACTTGGATG TTCCCACGTTTGTTTCTTTCTTGAAAGAAGTGGAGTCTCCTTATGAAGTCCATGACTATACCAGGGCCTATTTAGGAGATACTTCCGAG

GCCAAGGAGTTTGCCAAGCAGTTCCTTGAACGCCGTGCCAAACAGAAAGTCAACCAGCAGCGTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG GACTCT

GTCTGGGGGATGAACCATAGTACACTCCATTCGGTATTTCAGACCAATCAAAGCAACAACCAACAATCAAATTTTGAGGCTGTGCAAAGTGGCAAGAAGA

AGAAAAAGCAGAAGATGGTTCGAGCAGATCCCAGTTTATTAG GGTTTTCAGTCAACGCCTCGTCAGAGCGACTGAACATGGGTGAGATTGAGACTCTGG

ATGACTACTGAGTTCCTGCCGCTGTGCCAGCCTTCCCACTCCCGCCTAGTGACCATGGTTTCTCCTCATTGGACACAACATACGTTCACCATTTTCTCTG

TCACTCTGCAACAAATCACAGAACCAATCATCTCAGGCTTTTTTTTTTCCTAGCCCTTTGTGTCCAAGATTACTTTAGATCACTGTTGGTGAGCATCTCA

GACTGTACCTAGTGGACCAGCCCTTGTCTCAGGGTGGCAGTTGGGGCTGCTCCCCAGCAGAGCTAATGTTGCCAGCACACATTCACTGTGCGTTGATTTC

ATCTACTGTCTCCTGGAAGTGTGTTGGAATCTGCCAATAGCAGATCACTTTCTCTTATCACTTTTCTTGTTCTGTTTTGTTCTTTCTCCCCACCCCTCTA

TTCCACCCCATACCGGCAAAGGGCCTTAACTGGTGCAGTCATGAAGAGAGTTAATGGTTAATAGACATTGGCCAGCAACAAATCACCCCCTGGACAGTAA

CTTCTCTATTGCCACAGGCAGGCATAACTCTGTCTGTAGGTTGCATGACCATTGTTAACGTGGGGATTGCATCAGAGGCCTGAGAGGGGTGTAGATTGGC

TTGTTTGATGTTGCACACCCTCGCTGTTCTTTCTGAAGAAAGGATGCGTGTGTTCTTCATTAGATAGTAACTTTCTAAGCAAGCTGTGTTCTCCCTAACA

TATTCCAACGTTACTACTGGACAAAAGAAACCCTATGGCCTGGGACAGGGACTTAATTTTCCTTTCATATAAAAACTGATCTCCCCTCCTCCCATAAATA

TTTTTACTTCAAGGACTAGGACCAGTTTGTTTTGGGCCCTTATGTGAAAATTTGTCTCGTTTAAGAGGCATCTTTACCATATGTATGAATTTGTGTAATT

TCAACTCGGATAGGGATAAACTTTTGCTTCTGATAAAAGCTGGGAATTTCATCTGTTCCTCAGAGCACCGTGTGCATGTTTTGCCATGGCCCTGAAAAGG

TCTTGTGAAAAGATTCTGGGATGGCAAGTTGTTTGCCTTTTCTGAAAAGAGAACATACAAAGCCTGACCATCTTTAAGACCTTCATCCGTGGAAACCACT

ATGCAGGAGGATGCAATGGGGTATGGGGATGGCAGGCACAGGAGTGGGAGGCCTGCTCCATAGCAAGGCCAAGTGTACTCAAGCTCTGTACAGACAGACT

CTGACTGCTTCTGCTCCTCGCCTAGTGAACATCACCTGGGATAGTCGAACACCTCGGCGGCAGCTGTGGGTCAGCTGGGCCTGTGCAAGAGGTGCTGTGG

TGGGCAGCTCGGCATCTGTGCCTGGACAAGGCTGGAGTTGCTCTCAGAGCAGTTTGGTATTGGAAGATTATATTTGGTTTCTATTTTTATTATTTTGCAT

CACCATTCTCCCTATCCTTTCTTGCCTCTCTCCCTCCTAAATGTGTACAATAACTATACAGAGACTGCTACAAACTTGTAAATAGTTTTTGGATCAAATA

GCATAAGGAGATAGGAACCATTAAAATGTGAGACTCCTCTCCTTTGCTTTGTAAATTCAAAAGGGGGGGTGGGGAAGAGGGATAGTTAAAATGTTTACAA

AACTTTAAGCTCCCTCGGAACTTTTGCCAGTGTGGAGG
Translation
 - UNI10432 -  - UNI10722 - MAAETQTLNFGPEW - UNI26564 - WLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDYK

 - UNI12202 - IPFDLLEKEFLPILQEEPLPPLALVPFTEEEQ - UNI2704 - RNFSMSVNSAAVLRLTGRGGGGGTVVGAPRGRSSSRGRG -

 UNI156 - GRGRGECGFYQRSFDEVEGVFGRGGGREMHRSQSWEER - UNI10825 - RGDRRFEKPGRKDVG - UNI8789 - GRPNFEESGP

TSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPD DGPRSTGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDDDRDSL

PEWCLEDAEEEMGTFDSSGAFLSLK KVQKEPIPEEQEMDFRPVEEGEERSDSDSSHNEEAKEPDKTNRREGEKTDRAGAE EASEEVPQTSLSSARPGT

PSDHQPQEATQFERKDEPKAEQVEKAEEENRSENSLSAKVPSRGDE ETVPASQQPSTPLPPDTASPLLILSPPVPTPSSASRPVETAAVEAPGMSSVST

EPDDEEGLKHLEQ QAEKMVAYLQDSALDDERLTSKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQG - UNI15234 - GPFNNQEMAEWFQAGYFT

MSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHM GELDQERLTRQQELTALYQMQHLQYQQFLIQ QQQYAQVLAQQQKAALSSQQQQQLALLLQ

QFQALKMR RMSDQNIIPSVTRSVSVPDTGSIWELQPAASQPAV VWEGGSVWDLPLDTTAPGPSLEQLQQLEKAKAAK LEQERREAEMRAKREEEERK

RQEELRRQQEEILRRQQEEERKRREEEELARRKQ EEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELLRKQ - UNI3490 -

 EEEAAKWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELELQRQKDLMRQRQQQQEALRRLQQQQQQQQLAQMK - UNI3490 - LPSSSTW

GQQSNTATCQSQATLSLAEIQKLEEERERQLREE - UNI2581 - QRRQQRELMKALQQQQQQQQQQKLSGWGNVSKPAGTTKSLLEIQQEEARQMQK

QQQQQQQQQQQHQQSNRARNST HSNLHTSLGNSVWGSINTGPSNQWASELVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLS SKSVGVS

NRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDV VPTFVSFLKEVESPYEVHDYTRAYLGDTSEAKEFAKQFLERRAKQKVNQQRQQ

QQQQQQQQ DSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQSGKKKKKQKMVRADPSLLG GFSVNASSERLNMGEIETLDDY

For any suggestions or comments, please send an email to unitrap@crg.es