Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048047 (Zbtb33)
Chromosomal location
Chr X: 35542970 - 35550223 (+)
Description
zinc finger and BTB domain containing 33 Gene [Source:MGI (curated);Acc:Zbtb33-001]
RefSeq_dna
NM_020256 NM_001079513 
RefSeq_peptide
NP_064652.2 NP_001072981.1 
UniGene
Mm.413943 Mm.391248 
MGI
MGI:1927290 
Uniprot/SWISSPROT
Q8BN78 
Uniprot/SPTREMBL
A0PJC8 A2A3Z2 A2A3Z3 
Human Ortholog
ENSG00000177485 (ZBTB33)
Omim not available
UniTrap UNI24801
Vector Insertion
Chr X: 35543260 - 35545391
Public Clones not available
Private Clones OST205854 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115142
Sequence
GGAAACTGGAGCGACATTTAAAGCGGCAGCAGCGGCGCTGCGGAGTCCGGCTGCTTGGGGTAGGACTCTGACCCTGCCTCGGCCCCGAGGAGGAGAAAGC

GGCCGCCGCGGAGCAG - UNI24801 - GCATGGAGAGTAGAAAACTGATTTCTGCTACAGACATTCAGTACTCTGCCAGTCTGCTGAACTCCTTGAA

TGAACAGCGTGGCCATGGTCTCTTTTGTGATGTTACTGTTATTGTGGAAGACCGAAAATTCCGGGCCCATAGGAACATCCTTTCAGCCTCGAGTACATAC

TTCCATCAGCTCTTCTCAGTTGCTGGGCAAGTTGTTGAACTAAGCTTTATAAGAGCTGAGATTTTTGCAGAAATTCTGAACTATATCTACAGTTCCAAAG

TTGTCCGTGTTAGAGCAGATTTGCTTGACGAGTTAATTAAATCAGGGCAGTTACTAGGCGTGAAATTTATAGCAGAGCTTGGTGTCCCACTGTCACAGGT

TAAAAGCATATCAGGTACAGAACAGGATGGTACTGCTGAGACCTTACCTTCTAGTTCTAGTGACAAAAGCCTTGACATGGAAAAATCAAAAGATGAAGCC

CAAGATAATGGGGCTACAGTAATGCCCATTATAACTGAGTCTTTTTCACTATCTGCTGAAGATAATGAAATGAAAAAGATCATTGTTACTGACTCAGATG

ATGATGATGATGACGATGTCATTTTCTGCTCTGAAATTTTGCCTGCAAAGGAGGATTTGCCAAGTAACAACACAGCAACACAGGTCCAGCCTAACCCAGC

CTCTGTTGCTATTTCGGAAGTGACACCTTGCGCTAGCAATAACTCGCCCCCTGTAACAAACATCACACCTACTCAACTTCCCACTCCTGTGAATCAGGCA

ACTCTAAGCCAAACACAAGGAAGTGAAGAATTGCTAGTGTCTTCAGCTTCAACACATCTGACTCCTAACATTATTTTGTTAAATCAGGCTCCACTTACTG

CACCACCGAGTGCCAGTTCTTCACTCCCAAATCATATGTCCTCTTCAGTCAATGTCCTTGTACAGAATCAGCAGACGCCTAACAGTGCTGTTTTAACAGG

AAACAAGGCTGAGGAAGAGGAAGAAATTATAGATGATGATGATGACATCATTAGCTCCAGTCCAGACTCAGCAGTCAGTAATACATCTCTGGTCCCTCAG

GCTGATAACTCCAAAAGTACCACTTTAGATGGATCATTGACACAGAAGATGCAGATTCCTGTACTTCCTCAAGAGCCACCTTCTAATTCTTTAAAAATTT

CAGATGTCATTACTAGAAACACTAATGATCCAGGCTTAAGGTCAAAACATGTAATGGAGGGTCAGAAGATCATTACATTAGATACAGCTACTGAAATCGA

AGGCTTGTCAACTGGTTGCAAGGTTTATGCAAATATCGGTGAAGATACTTACGATATAGTGATCCCTGTCAAAGATGACCCTGATGGAGGGGAGGCCAAA

CTTGATAATGAGCTACCAAAAACATCTGGCAGTGAGCCACCAAACAAGCGTATGAAAGTAAAACATGATGATCACTATGAGTTAATAGTAGATGGAAGGG

TCTATTATATTTGCATTGTATGCAAAAGGTCCTATGTCTGTCTGACAAGCTTGCGAAGACATTTTAACATTCATTCTTGGGAGAAGAAGTATCAGTGCCG

TTACTGTGATAAAGTATTTCCTCTTGCAGAATACCGCACCAAGCATGAAATCCATCACACAGGGGAGCGAAGGTATCAGTGTTTAACGTGTGGCAAATCT

TTCATCAACTATCAGTTTATGTCTTCACACATAAAGTCAGTTCATAGTCAAGATCCTTCTGGGGACTCAAAGCTTTATCGCTTACATCCATGCAAGTCTT

TACAGATCAGACAGTATGCATACCTTTCTAATAAGTCAAGTGCTATGCCTGTCATGAAGGATGATGCTGTTGGATACAAGGTTGATGCTGGAAAAGAGCC

TCCAGTAGGGACCACATCTACTCCTCCTCAGAACAAGTCAACGTTCTGGGAAGATATTTTTATTCAGCAAGAAAATGATTCCATTTTTAAACAGAATGTA

ACCGATGGCAGTACTGAGTTTGAATTTATAATACCAGAATCTTACTGAACTCTTGGAATATCAGAAAGTTTGGGTTGAATTAAGGGGTGTGGATTTCAGA

AGACCTGTAAAACAAGTCAAGGTAGAAACGTGTTAATTTGATCTACCATGTCCTCTGAAAGTAGACTAGTTGCATTGTTAATTTTTAGAAACAGTTTTCC

TTAAAAGTTTGAGTAGAGATTGAACACCCCTGAAGTATCTGTATAGTTTAGCTTTCCGCTCATTTGAAAAGGTAAATTTTTAAAGGTGCAGGGACATAGT

TTTCTGAGTAGACTTTGAAGAAATCTAACTGTTCTTTGAGAATTACTGGAGTTACTAATATATACCCTAGTACAGCTGATAATGTTCCCCTTCCAGGTTA

ACACTCTACTGCTGATTTTTCAATTTTCTTAATGTTAAGTCTAAGTGTGTTGTGTTTTATATGGCATAAGAAGTAATAAATGTCCAAAAGTTGTGCTAGT

AAATACCAGAGTAAGTCCTCACTTGGTTTATTCTGTCAGTCCAAATGGAGATCAGCCTTCTGCTTCTCTCCCACTGTGAAATAGCCATGCAAACAAGTCT

CTCCTATGAAGACTGAGTTCGTTTTAGCTAACTAGGATTAACCATAGTCTGCTTTTGATGGCAAGGCCACTATATGCCTTTAAACTATGGTCCTGGGGTT

ACAGGGAGCTAGCAAACATGCATGTGGTGTAGCCGGGGGATTCCTTTGTGCTTATCATTGCTCTTCTGCCTTTATATGCTAGCAGCAGTCAAGTTGAATG

GAGAGCTCCTTTTGTTAATTATGAAAACGTTCCCACAAAATGCTGTGAATTTATTATCTGAAAGCCACCAAATGCATCTTTATATGTAATGCTAGTAAAT

GTTGCGATTCCATAGATGAGACTTGTGGTTTGGGGGCGGGGGGCGGGGGGGGGGGCGGCGAGGAGGGGGAGGGAGGCTGCTGGCACAGCTTTTTAAATGC

TCATGTTAGAATCTCCAGTGGGAAGTTTTCATTTTAAGTAATTTAAATGGCAATCTAGAATTGTCATTTCAACAAGGTCTTTTGAGTTTTTTTAACCCCT

TAAAATAAGTTCCAATCTGTGTGCAAACTGCTGCTATATTATAGCAGAAACCATAACTGGAATACTGGAGGCAAATGGCTTCTTGTTTATTTTGACAATA

ATGCCAGCTTTCCTCCTTTTAAGATGACACATATTTAAACACTTAGAAGAATTTAAAATTTACCCAAAAGCTAGTAATAAAAGAAAGCAGGTTGGAACAG

ATATATAGTTTAGCATTTATAACAGATTTAATACAACTCTGTAAAAAAATTAATGTTTTGCAATGGAAAAAATAATAGATACTGAAAATGGTTGTTGTTG

GATAGTTGTTAGTCATTTGTGATCTTGCTTATATATTTCTTAGTTCAGCATAAGGTATTTTCATTCTCTGTGTATTTTTGTCTATTTCTTGACATTGAAC

GTAAAGCTTTAATCATGCTCTTTTATATATAGGTCATTCTTCTGGTTAAACTAGGTGTGAAGATGAAGTTTTCAGTGTTTCTTAAGTTGGTAGCTGAGGG

TATCAAGAATCAGTATTTGCAGGAATACAAAGGAAGAGGATAGTCCCGGCTTACCAAGAGGTAGAATGCTGTACATTTATGTTTTGGTTTTTGGTAAGCT

TAAGCCTACCATCATAAGCTAACTCTTAGAAAACTTAAAATCACTTTATAGCTCAAGACTCTGATTTCTCTCACAATATTCATTTCCTTTCTCTGTAGCT

ATTGATGGCACTACCTTTTGAATATAGGGTCTGCTCAAAAGCAGCTCTCAATTGAAAAATGTGTTTCATGAATGCAGTCTCAGCAGTTAGACATAATTGC

TTCTACCAGTGTCGGTGATAAGGATGTTTTGGTGTCAACTGCTAGGTAAAATCAGTTTGTCATAATAAGACTTGCTAATTCCTACAAGCCTATTACAACA

AACTGGGAATTTTATAATGAAAAACTATCTGTTCTGAATAACATTGGTCAAATGATTCACTACTACTGCTGTGCTCTGCTCTGTCAAGTCTCTAATAAGA

ACTTTTAAACTTTGTGCCTACTGAAAAGCAGCTTCTAGAGTTTGCAGGGAGGACAAGAACTAGAAAGTTAAATTGTAATTTTGCCAGGAAGACTCTTCCA

TGTGTTCGGGGATTTTTTAAATAGCTTTATATATCCAACCTTGAGAGGTTTTTGTGGAATACTCCTCTGGACAATAACTCTTTACTCCTAGCCATTATTA

GATTGGAATTTTGTAGCAAAATGCTATTTAAAATCTACTGTGAATATTTTTCTACTTAGCTTTCTGACTACTGATTTTTTTTTTTTTTACTGTTCTTTCA

AGTTGGCTTCAATTTCACTCAACTTCTAAATTATCTGTAGTTATTTTTGGTAGAATCTATTTGAAATAGTAAATTTGTTCAAAGTATAAGCCAACATTTT

AAAAAGGTTATAGCATTCTTGCAAGATTAAATAGGGATAATTTTGTTATCATTTTGGTGGTCACTATCCTCCACTCAGAGTCACTGAAGAATTTGTTCAA

TTGGGCTAAAAAGATAAAAACAAATGAACCCTGCTGTAGGCATTTAAAATGTTATAGTGTGTGCATTTTGAGGAATTAAATGTAAATTCAATAGCACTGG

CTTCTTTACCTCTGTTAGTCATATGAAACCTTGTTCATTTCCCCAATTACTGTACATTTTCATATTTGTACAATCTTCCTTATCATAAGTTCTGCTTTTC

ATTAACTGTTACCTGATATTAGTTCATAGAGTTTATCACAAAATAAAACATATTCATTCTAA
Translation
 - UNI24801 - MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIY

SSKVVRVRADLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTEQDGTAETLPSSSSDKSLDMEKSKDEAQDNGATVMPIITESFSLSAEDNEMKKIIVT

DSDDDDDDDVIFCSEILPAKEDLPSNNTATQVQPNPASVAISEVTPCASNNSPPVTNITPTQLPTPVNQATLSQTQGSEELLVSSASTHLTPNIILLNQA

PLTAPPSASSSLPNHMSSSVNVLVQNQQTPNSAVLTGNKAEEEEEIIDDDDDIISSSPDSAVSNTSLVPQADNSKSTTLDGSLTQKMQIPVLPQEPPSNS

LKISDVITRNTNDPGLRSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDGGEAKLDNELPKTSGSEPPNKRMKVKHDDHYELIV

DGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYQCRYCDKVFPLAEYRTKHEIHHTGERRYQCLTCGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHP

CKSLQIRQYAYLSNKSSAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNKSTFWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
Transcript ENSMUST00000049740
Sequence
GGAAACTGGAGCGACATTTAAAGCGGCAGCAGCGGCGCTGCGGAGTCCGGCTGCTTGGGGTAGGACTCTGACCCTGCCTCGGCCCCGAGGAGGAGAAAGC

GGCCGCCGCGGAGCAGGTGAGGAGTGGGCTGGGCACCGGGCCCGGGAGACGGAGCCCGCCTACGCCTTCCATGCCCTGGCCGCGCCTACGCTTGCGGCCG

CCTCGCTTGAACCAGGAAGCAGCGGAGCCCGAGGCCTTGGCTCCTCTGCTCTTTCTTTGTGTGGGTCCCGGAGCTCTACCAAGAGAACCG - UNI2480

1 - GCATGGAGAGTAGAAAACTGATTTCTGCTACAGACATTCAGTACTCTGCCAGTCTGCTGAACTCCTTGAATGAACAGCGTGGCCATGGTCTCTTTT

GTGATGTTACTGTTATTGTGGAAGACCGAAAATTCCGGGCCCATAGGAACATCCTTTCAGCCTCGAGTACATACTTCCATCAGCTCTTCTCAGTTGCTGG

GCAAGTTGTTGAACTAAGCTTTATAAGAGCTGAGATTTTTGCAGAAATTCTGAACTATATCTACAGTTCCAAAGTTGTCCGTGTTAGAGCAGATTTGCTT

GACGAGTTAATTAAATCAGGGCAGTTACTAGGCGTGAAATTTATAGCAGAGCTTGGTGTCCCACTGTCACAGGTTAAAAGCATATCAGGTACAGAACAGG

ATGGTACTGCTGAGACCTTACCTTCTAGTTCTAGTGACAAAAGCCTTGACATGGAAAAATCAAAAGATGAAGCCCAAGATAATGGGGCTACAGTAATGCC

CATTATAACTGAGTCTTTTTCACTATCTGCTGAAGATAATGAAATGAAAAAGATCATTGTTACTGACTCAGATGATGATGATGATGACGATGTCATTTTC

TGCTCTGAAATTTTGCCTGCAAAGGAGGATTTGCCAAGTAACAACACAGCAACACAGGTCCAGCCTAACCCAGCCTCTGTTGCTATTTCGGAAGTGACAC

CTTGCGCTAGCAATAACTCGCCCCCTGTAACAAACATCACACCTACTCAACTTCCCACTCCTGTGAATCAGGCAACTCTAAGCCAAACACAAGGAAGTGA

AGAATTGCTAGTGTCTTCAGCTTCAACACATCTGACTCCTAACATTATTTTGTTAAATCAGGCTCCACTTACTGCACCACCGAGTGCCAGTTCTTCACTC

CCAAATCATATGTCCTCTTCAGTCAATGTCCTTGTACAGAATCAGCAGACGCCTAACAGTGCTGTTTTAACAGGAAACAAGGCTGAGGAAGAGGAAGAAA

TTATAGATGATGATGATGACATCATTAGCTCCAGTCCAGACTCAGCAGTCAGTAATACATCTCTGGTCCCTCAGGCTGATAACTCCAAAAGTACCACTTT

AGATGGATCATTGACACAGAAGATGCAGATTCCTGTACTTCCTCAAGAGCCACCTTCTAATTCTTTAAAAATTTCAGATGTCATTACTAGAAACACTAAT

GATCCAGGCTTAAGGTCAAAACATGTAATGGAGGGTCAGAAGATCATTACATTAGATACAGCTACTGAAATCGAAGGCTTGTCAACTGGTTGCAAGGTTT

ATGCAAATATCGGTGAAGATACTTACGATATAGTGATCCCTGTCAAAGATGACCCTGATGGAGGGGAGGCCAAACTTGATAATGAGCTACCAAAAACATC

TGGCAGTGAGCCACCAAACAAGCGTATGAAAGTAAAACATGATGATCACTATGAGTTAATAGTAGATGGAAGGGTCTATTATATTTGCATTGTATGCAAA

AGGTCCTATGTCTGTCTGACAAGCTTGCGAAGACATTTTAACATTCATTCTTGGGAGAAGAAGTATCAGTGCCGTTACTGTGATAAAGTATTTCCTCTTG

CAGAATACCGCACCAAGCATGAAATCCATCACACAGGGGAGCGAAGGTATCAGTGTTTAACGTGTGGCAAATCTTTCATCAACTATCAGTTTATGTCTTC

ACACATAAAGTCAGTTCATAGTCAAGATCCTTCTGGGGACTCAAAGCTTTATCGCTTACATCCATGCAAGTCTTTACAGATCAGACAGTATGCATACCTT

TCTAATAAGTCAAGTGCTATGCCTGTCATGAAGGATGATGCTGTTGGATACAAGGTTGATGCTGGAAAAGAGCCTCCAGTAGGGACCACATCTACTCCTC

CTCAGAACAAGTCAACGTTCTGGGAAGATATTTTTATTCAGCAAGAAAATGATTCCATTTTTAAACAGAATGTAACCGATGGCAGTACTGAGTTTGAATT

TATAATACCAGAATCTTACTGAACTCTTGGAATATCAGAAAGTTTGGGTTGAATTAAGGGGTGTGGATTTCAGAAGACCTGTAAAACAAGTCAAGGTAGA

AACGTGTTAATTTGATCTACCATGTCCTCTGAAAGTAGACTAGTTGCATTGTTAATTTTTAGAAACAGTTTTCCTTAAAAGTTTGAGTAGAGATTGAACA

CCCCTGAAGTATCTGTATAGTTTAGCTTTCCGCTCATTTGAAAAGGTAAATTTTTAAAGGTGCAGGGACATAGTTTTCTGAGTAGACTTTGAAGAAATCT

AACTGTTCTTTGAGAATTACTGGAGTTACTAATATATACCCTAGTACAGCTGATAATGTTCCCCTTCCAGGTTAACACTCTACTGCTGATTTTTCAATTT

TCTTAATGTTAAGTCTAAGTGTGTTGTGTTTTATATGGCATAAGAAGTAATAAATGTCCAAAAGTTGTGCTAGTAAATACCAGAGTAAGTCCTCACTTGG

TTTATTCTGTCAGTCCAAATGGAGATCAGCCTTCTGCTTCTCTCCCACTGTGAAATAGCCATGCAAACAAGTCTCTCCTATGAAGACTGAGTTCGTTTTA

GCTAACTAGGATTAACCATAGTCTGCTTTTGATGGCAAGGCCACTATATGCCTTTAAACTATGGTCCTGGGGTTACAGGGAGCTAGCAAACATGCATGTG

GTGTAGCCGGGGGATTCCTTTGTGCTTATCATTGCTCTTCTGCCTTTATATGCTAGCAGCAGTCAAGTTGAATGGAGAGCTCCTTTTGTTAATTATGAAA

ACGTTCCCACAAAATGCTGTGAATTTATTATCTGAAAGCCACCAAATGCATCTTTATATGTAATGCTAGTAAATGTTGCGATTCCATAGATGAGACTTGT

GGTTTGGGGGCGGGGGGCGGGGGGGGGGGCGGCGAGGAGGGGGAGGGAGGCTGCTGGCACAGCTTTTTAAATGCTCATGTTAGAATCTCCAGTGGGAAGT

TTTCATTTTAAGTAATTTAAATGGCAATCTAGAATTGTCATTTCAACAAGGTCTTTTGAGTTTTTTTAACCCCTTAAAATAAGTTCCAATCTGTGTGCAA

ACTGCTGCTATATTATAGCAGAAACCATAACTGGAATACTGGAGGCAAATGGCTTCTTGTTTATTTTGACAATAATGCCAGCTTTCCTCCTTTTAAGATG

ACACATATTTAAACACTTAGAAGAATTTAAAATTTACCCAAAAGCTAGTAATAAAAGAAAGCAGGTTGGAACAGATATATAGTTTAGCATTTATAACAGA

TTTAATACAACTCTGTAAAAAAATTAATGTTTTGCAATGGAAAAAATAATAGATACTGAAAATGGTTGTTGTTGGATAGTTGTTAGTCATTTGTGATCTT

GCTTATATATTTCTTAGTTCAGCATAAGGTATTTTCATTCTCTGTGTATTTTTGTCTATTTCTTGACATTGAACGTAAAGCTTTAATCATGCTCTTTTAT

ATATAGGTCATTCTTCTGGTTAAACTAGGTGTGAAGATGAAGTTTTCAGTGTTTCTTAAGTTGGTAGCTGAGGGTATCAAGAATCAGTATTTGCAGGAAT

ACAAAGGAAGAGGATAGTCCCGGCTTACCAAGAGGTAGAATGCTGTACATTTATGTTTTGGTTTTTGGTAAGCTTAAGCCTACCATCATAAGCTAACTCT

TAGAAAACTTAAAATCACTTTATAGCTCAAGACTCTGATTTCTCTCACAATATTCATTTCCTTTCTCTGTAGCTATTGATGGCACTACCTTTTGAATATA

GGGTCTGCTCAAAAGCAGCTCTCAATTGAAAAATGTGTTTCATGAATGCAGTCTCAGCAGTTAGACATAATTGCTTCTACCAGTGTCGGTGATAAGGATG

TTTTGGTGTCAACTGCTAGGTAAAATCAGTTTGTCATAATAAGACTTGCTAATTCCTACAAGCCTATTACAACAAACTGGGAATTTTATAATGAAAAACT

ATCTGTTCTGAATAACATTGGTCAAATGATTCACTACTACTGCTGTGCTCTGCTCTGTCAAGTCTCTAATAAGAACTTTTAAACTTTGTGCCTACTGAAA

AGCAGCTTCTAGAGTTTGCAGGGAGGACAAGAACTAGAAAGTTAAATTGTAATTTTGCCAGGAAGACTCTTCCATGTGTTCGGGGATTTTTTAAATAGCT

TTATATATCCAACCTTGAGAGGTTTTTGTGGAATACTCCTCTGGACAATAACTCTTTACTCCTAGCCATTATTAGATTGGAATTTTGTAGCAAAATGCTA

TTTAAAATCTACTGTGAATATTTTTCTACTTAGCTTTCTGACTACTGATTTTTTTTTTTTTTACTGTTCTTTCAAGTTGGCTTCAATTTCACTCAACTTC

TAAATTATCTGTAGTTATTTTTGGTAGAATCTATTTGAAATAGTAAATTTGTTCAAAGTATAAGCCAACATTTTAAAAAGGTTATAGCATTCTTGCAAGA

TTAAATAGGGATAATTTTGTTATCATTTTGGTGGTCACTATCCTCCACTCAGAGTCACTGAAGAATTTGTTCAATTGGGCTAAAAAGATAAAAACAAATG

AACCCTGCTGTAGGCATTTAAAATGTTATAGTGTGTGCATTTTGAGGAATTAAATGTAAATTCAATAGCACTGGCTTCTTTACCTCTGTTAGTCATATGA

AACCTTGTTCATTTCCCCAATTACTGTACATTTTCATATTTGTACAATCTTCCTTATCATAAGTTCTGCTTTTCATTAACTGTTACCTGATATTAGTTCA

TAGAGTTTATCACAAAATAAAACATATTCATTCTAA
Translation
 - UNI24801 - MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIY

SSKVVRVRADLLDELIKSGQLLGVKFIAELGVPLSQVKSISGTEQDGTAETLPSSSSDKSLDMEKSKDEAQDNGATVMPIITESFSLSAEDNEMKKIIVT

DSDDDDDDDVIFCSEILPAKEDLPSNNTATQVQPNPASVAISEVTPCASNNSPPVTNITPTQLPTPVNQATLSQTQGSEELLVSSASTHLTPNIILLNQA

PLTAPPSASSSLPNHMSSSVNVLVQNQQTPNSAVLTGNKAEEEEEIIDDDDDIISSSPDSAVSNTSLVPQADNSKSTTLDGSLTQKMQIPVLPQEPPSNS

LKISDVITRNTNDPGLRSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDGGEAKLDNELPKTSGSEPPNKRMKVKHDDHYELIV

DGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYQCRYCDKVFPLAEYRTKHEIHHTGERRYQCLTCGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHP

CKSLQIRQYAYLSNKSSAMPVMKDDAVGYKVDAGKEPPVGTTSTPPQNKSTFWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

For any suggestions or comments, please send an email to unitrap@crg.es