Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048058 (Ldlrad3)
Chromosomal location
Chr 2: 101790358 - 102026534 (-)
Description
low density lipoprotein receptor class A domain containing 3 Gene [Source:MGI (curated);Acc:Ldlrad3-001]
RefSeq_dna
NM_178886 
RefSeq_peptide
NP_849217.2 
UniGene
Mm.35116 
MGI
MGI:2138856 
Uniprot/SWISSPROT
A2AR95 
Uniprot/SPTREMBL
B2RR20 
Human Ortholog
ENSG00000179241 (LDLRAD3)
Omim not available
UniTrap UNI29572
Vector Insertion
Chr 2: 101954317 - 102026516
Public Clones (sanger) E324E12 (ggtc) E038E11 (ggtc) D118F10 (ggtc) E112E08 (ggtc)
D172E05 (ggtc) E325E05 (ggtc) 5SE285B07 (ggtc) E077E03 (ggtc) CMHD-GT_536A3-5S (cmhd)
IST10817H1 (tigm) IST14939F12 (tigm) IST10332H5 (tigm) IST14356H6 (tigm)
IST10735B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12843
Vector Insertion
Chr 2: 101953862 - 101954317
Public Clones CMHD-GT_426A3-3 (cmhd) CMHD-GT_536A3-3 (cmhd) CMHD-GT_371G8-3 (cmhd) CMHD-GT_495B8-3 (cmhd)
Private Clones OST456373 (lexicon) OST454383 (lexicon) OST453580 (lexicon) OST432053 (lexicon)
OST423251 (lexicon) OST419722 (lexicon) OST379603 (lexicon) OST370019 (lexicon)
OST369008 (lexicon) OST360765 (lexicon) OST351454 (lexicon) OST345084 (lexicon)
OST334054 (lexicon) OST333720 (lexicon) OST317831 (lexicon) OST310354 (lexicon)
OST309508 (lexicon) OST304266 (lexicon) OST281635 (lexicon) OST259963 (lexicon)
OST259768 (lexicon) OST243017 (lexicon) OST235136 (lexicon) OST221459 (lexicon)
OST194542 (lexicon) OST131314 (lexicon) OST123339 (lexicon) OST111851 (lexicon)
OST111655 (lexicon) OST85426 (lexicon) OST62811 (lexicon) OST60522 (lexicon)
OST54624 (lexicon) OST51109 (lexicon) OST45102 (lexicon) OST43207 (lexicon)
OST43149 (lexicon) OST39854 (lexicon) OST32469 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16355
Vector Insertion
Chr 2: 101910216 - 101953689
Public Clones 5SE287E02 (ggtc) IST14734B2 (tigm) IST12128G10 (tigm) IST12216B1 (tigm)
IST12342E1 (tigm) IST12346F10 (tigm) IST10482C8 (tigm) IST14531H5 (tigm)
Private Clones OST462464 (lexicon) OST404958 (lexicon) OST379461 (lexicon) OST332580 (lexicon)
OST313034 (lexicon) OST226715 (lexicon) OST222900 (lexicon) OST130021 (lexicon)
OST59261 (lexicon) OST58842 (lexicon) OST43402 (lexicon) OST34465 (lexicon)
OST30248 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22106
Vector Insertion
Chr 2: 101898199 - 101910089
Public Clones not available
Private Clones OST308333 (lexicon) OST203426 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1240
Vector Insertion
Chr 2: 101795332 - 101898063
Public Clones DD0948 (sanger) RST448 (baygenomics) XA360 (baygenomics) RST373 (baygenomics)
GST142 (baygenomics) XST123 (baygenomics) Ex186 (baygenomics)
Private Clones OST445445 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058790
Sequence
ACCGAGGCCGCGGGGCAGCAACGTCGCTGGGCAGCGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCACTGCGG -

 UNI12843 - - UNI29572 - AGAGCCAGCTGCTCCCTGGGAACAACTTCACCAACGAGTGCAACATCCCAGGTAACTTCATGTGCAGCAACGGGC

GGTGCATCCCGGGCGCCTGGCAGTGTGACGGGCTGCCTGACTGCTTCGACAAGAGTGACGAGAAGGAATGCC - UNI16355 - CCAAAGCAAAATCA

AAATGTGGCCCGACCTTCTTCCCCTGCGCCAGTGGCATCCACTGTATCATCGGCCGCTTCCGCTGCAATGGATTTGAGGACTGTCCCGACGGCAGCGACG

AGGAGAACTGCA - UNI22106 - CAGCGAACCCCCTGCTTTGCTCCACGGCTCGCTACCACTGCAGGAACGGCCTGTGCATCGACAAGAGCTTCATC

TGCGATGGTCAGAATAACTGTCAAGACAACAGTGACGAGGAGAGCTGCGAGAGTTCTCTAG - UNI1240 - AACCAGGCAGCGGGCAGGTGTTTGTG

ACCTCGGAGAACCAGCTTGTGTACTACCCCAGCATCACGTACGCCATCATCGGCAGCTCTGTCATCTTCGTGCTGGTGGTGGCCCTGCTCGCACTGGTCC

TGCATCATCAGCGAAAGCGAAACAACCTCATGACCCTCCCTGTGCACCGGCTGCAGCATCCTGTGCTGCTCTCTCGCCTGGTGGTCCTGGACCACCCTCA

CCACTGCAACGTCACCTACAATGTCAATAATGGTGTTCAGTATGTGGCTACCCAGGCTGAACAAAATGCCTCGGAAGTAGGCTCTCCACCCTCCTATTCA

GAGGCCCTGCTGGACCAAAG ACCTGCATGGTACGACCTTCCTCCACCACCCTATTCATCTGACACCGAGTCTCTGAACCAAGCTGACCTGCCTCCTTAC

CGCTCCCGGTCAGGAAGTGCCTACAGTGCCAGCTCCCAGGCAGCCAGCAGCCTCCTGAGTGTGGAAGCCAGCAGCCACAACCCAGAGCAGCCTGGCTCTC

CAGAGGGCTCTGCTGAGCCCAGAGACTCTGTGCCCAGTCAGGGCACCGAAGAAGTATAAAATCCAGCGATTCCAAAGTCCATATGGGTAGATCCTCTCCA

ACTTGTTGAATTCTATCAGACTGTGCTCATGGGACACTCTTTGAGCTCCTTTTGAGGATGTCTCCAGTTGAAATTTTGGGGTGCTCACTATACCTTCTCC

TCCAGATTTCAGGGATGTTCTTTGGAATGACCTGGCACTCCTCCAGCCACTTAGTTAACAGGATGCATTGCCGTCTTTCTCTGCACAGTCACTGTTCCTT

CAGGGCCTGTGATTAACAGACTCCTACTTCAGATGACTGTGCGATTGTTGGTCCATTCCAGTAGTCTTATGACTGGACAGGCGGCCGGGTGAAGCCATGT

ATGTAAATAGTCTTTGGCAGGGTTCTAGGGCCATGTCACACATTCAGGAGGTCAGAAGACATCAGACCAGAGTCTCTACTGAGCTGCCAACTTATAGATA

CATTTGGAGACTTAGTTTGGAGGATTCTTACAAAAAGGCCATTACTGGATGGCCACTCAAAAAAGTGTCCAGGAGAACATCAAATCCCGTTTTGTACTCT

CCTATGCATCGATCTTACTCCAGCAGAGGCCAAAGAAAATCTCTGGCATGAGCAACAGCTTTCAACTCTCCAAACTCTAGTTTGGTTTTATGAAAGACTC

AGAAACCTCCACCCTGGCCTTACAGACTTGCCCAAGAGTCCTCATTCTGAGATCTTTCTAGAAGGGCAGAGCCTCAGCAACGTCCTTGAATAAGTAGGAA

GCCCCTGGCATGAGTTCCTAGCTGCTAATGTGTAGGTTACCAGAGTCTGCTCCTGCCTTGGCCCCATCATCCTTTTCCTGCCTTCTGGATTGTCCCCTTC

CAAGATGACCTGCCATAGCTAAGGATAAGGACCCAAATTAAGCCGGTCAAAATTCTGATCTAACCGTTTGCCCCAGGAAAACAGACCCAGTCTGGCATGT

TCATCCATGCAACTTCCTTGATAGGCTCCTAAGTTCTATGAACACTTGGGAGCCTATTGTCCATGTGCATTTGGACATAAGGACACGTTTTTCTCTAACT

TACATGAGAACCACATTCAATACCATCCATGAGAATTCTCAGGTCCCTGTACTACACACACAACCCCCAGGACAGTGCACCAAGTCAGGGTTAGGGTTAG

AGTGAGGGTCAGGCCTGGCCAGACATCTGGCAGTTTCTCCTGAGAGAAGTGGGCAACAGATAAATCTTGGAGTCAAGATTTCCCATTGGATTTTGTTTTT

TTAAAGTCTCTTAGAAATGCATTTGAAACAGTGTGTTTGTCTTTTCCCTTCTAGTTAAGGGACTATTTATATGTGTATAGGAAAGCTATCTCTTTGCTTT

TCTTATTTCTCTTTCAGTGAGGTCCAAAGAAAGATGCAAAAAGAAATGCTGCCTTTCCCATCCCATCCCATAATGTCACCTCAGACTCACATACACGCTG

AGCATCTACACTGGGTCATCGTGGAGTCATTATTTATTGAGTTACTGAGACACGCAGAGACAAGTCCACCATCCACTGTTTGTTTGGATTACCTTTCCTC

CTCCTTGATGCCCAGCCAGTCCTAGTGCATGCCACCACCACGCACCCCCACCAACCAGGCAATAATGGGTAAACCATACTAACTAGGGACAAAACTGGAA

CCAGATGGTGCCACCTCAGGCAGCTGCCACCCATTCAAAGCATTTTTCCACTGCTAACAAAAGTTTCAATAACCTGTTCGATGCTAATTAAAAGGGAGCC

TGCAGGGAGCAGGGATGAAGTGGCCTTCAGTGATGTTGTACTGACTTCCTTTTTAACCAAATCCAAAGTAGACTGCAGGAAAGGTAACTAGCCACTTGGG

GTTTTGTTTGGTTTTGGTTTTGTGTAAATAAGCCTAGCTGTTTGCTTTTTTCATTGTTAAAATAGAAATTGAGTTGGTGTGTGTGTGTGTGTGTGTGTGT

GTGTGTGTGTGTGTGTGTAACCCAATGAAGAAAGAACCTGGGTGGCAGACAGAGCTTTTCTGGCTGCACATCTCATCCCAGTGAGTCAGAGTCGCTCTTC

CCTTCCTTTGATGGGTCCCCGCTTCTTTTTGGTGCTCTGAAAGTTGTCTGGAGGAAAGGATTCTAATTTTAATTAATTGTGCAGTGAGCTAATCTCAGGA

GCTTTTCTGCTTCAAGGCATTTTAGGGAAAACAAATGGTTTTAGTAGATAAGGAGAGCCTATTAATGTTGGGGTTTTGTTTTGTTTCCAAACAAACACAG

GAACATTTTTTTACTATAGATTTGGTTTTTAATGGATTTTTTTAAAATAATAATCATAAGATAGCAAAGCTCGGGGACATGGGGTTTTTTCCCCCTGATT

TTTTCAAGATACCAAGTAAGTGGCTAACAATATTTTTTTTAATTCGTTCCAGTCAGGATTTTTTAAATACTATATTGCCTAATTTACACCAGCCAAAAAA

CTGCCTCTTCTCCATTGTCTCTCCTCCTGTAAGATCAACACTTCATTTTTAACACTACACTAGATTCACTGTGGTTGGAACTCACTGCCTAACTTAACTC

CCTCTACCTTGTAATTGATGATTGTTTTTGAAATGCAACTAAGATATTAATAAATAGCGTGTGATATTCAAAGTTATATAAACTGGAAGGTTGTATGTGG

TTGCTTCTTGTTTTTTTGTTTGTTTTGTTTTTTGAATTGGCCCATTTTTTAAAAAAAATTTTATACTCTCAAATAAACTTTCAGTTTCATTCTTTC
Translation
MWLLGPLCLLLSSTAE - UNI12843 - - UNI29572 - ESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECP - UNI1

6355 - PKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCT - UNI22106 - TANPLLCSTARYHCRNGLCIDKSFICDGQNNCQDNS

DEESCESSLE - UNI1240 - EPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHH

CNVTYNVNNGVQYVATQAEQNASEVGSPPSYSEALLDQR RPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSAYSASSQAASSLLSVEASSHNPEQPGS

PEGSAEPRDSVPSQGTEEV
Transcript ENSMUST00000111222
Sequence
AACGTCGCTGGGCAGCGGAGCGGCGGCCGCGCCATGTGGCTGCTGGGGCCGCTGTGCCTGCTGCTGAGCAGCACTGCGG - UNI12843 - - UNI29

572 - AGAGCCAGCTGCTCCCTGGGAACAACTTCACCAACGAGTGCAACATCCCAG - UNI16355 - CCAAAGCAAAATCAAAATGTGGCCCGACC

TTCTTCCCCTGCGCCAGTGGCATCCACTGTATCATCGGCCGCTTCCGCTGCAATGGATTTGAGGACTGTCCCGACGGCAGCGACGAGGAGAACTGCA - 

UNI22106 - CAGCGAACCCCCTGCTTTGCTCCACGGCTCGCTACCACTGCAGGAACGGCCTGTGCATCGACAAGAGCTTCATCTGCGATGGTCAGAAT

AACTGTCAAGACAACAGTGACGAGGAGAGCTGCGAGAGTTCTCTAG - UNI1240 - AACCAGGCAGCGGGCAGGTGTTTGTGACCTCGGAGAACCAG

CTTGTGTACTACCCCAGCATCACGTACGCCATCATCGGCAGCTCTGTCATCTTCGTGCTGGTGGTGGCCCTGCTCGCACTGGTCCTGCATCATCAGCGAA

AGCGAAACAACCTCATGACCCTCCCTGTGCACCGGCTGCAGCATCCTGTGCTGCTCTCTCGCCTGGTGGTCCTGGACCACCCTCACCACTGCAACGTCAC

CTACAATGTCAATAATGGTGTTCAGTATGTGGCTACCCAGGCTGAACAAAATGCCTCGGAAGTAGGCTCTCCACCCTCCTATTCAGAGGCCCTGCTGGAC

CAAAG ACCTGCATGGTACGACCTTCCTCCACCACCCTATTCATCTGACACCGAGTCTCTGAACCAAGCTGACCTGCCTCCTTACCGCTCCCGGTCAGGA

AGTGCCTACAGTGCCAGCTCCCAGGCAGCCAGCAGCCTCCTGAGTGTGGAAGCCAGCAGCCACAACCCAGAGCAGCCTGGCTCTCCAGAGGGCTCTGCTG

AGCCCAGAGACTCTGTGCCCAGTCAGGGCACCGAAGAAGTATAAAATCCAGCGATTCCAAAGTCCATATGGGTAGATCCTCTCCAACTTGTTGAATTCTA

TCAGACTGTGCTCATGGGACACTCTTTGAGCTCCTTTTGAGGATGTCTCCAGTTGAAATTTTGGGGTGCTCACTATACCTTCTCCTCCAGATTTCAGGGA

TGTTCTTTGGAATGACCTGGCACTCCTCCAGCCACTTAGTTAACAGGATGCATTGCCGTCTTTCTCTGCACAGTCACTGTTCCTTCAGGGCCTGTGATTA

ACAGACTCCTACTTCAGATGACTGTGCGATTGTTGGTCCATTCCAGTAGTCTTATGACTGGACAGGCGGCCGGGTGAAGCCATGTATGTAAATAGTCTTT

GGCAGGGTTCTAGGGCCATGTCACACATTCAGGAGGTCAGAAGACATCAGACCAGAGTCTCTACTGAGCTGCCAACTTATAGATACATTTGGAGACTTAG

TTTGGAGGATTCTTACAAAAAGGCCATTACTGGATGGCCACTCAAAAAAGTGTCCAGGAGAACATCAAATCCCGTTTTGTACTCTCCTATGCATCGATCT

TACTCCAGCAGAGGCCAAAGAAAATCTCTGGCATGAGCAACAGCTTTCAACTCTCCAAACTCTAGTTTGGTTTTATGAAAGACTCAGAAACCTCCACCCT

GGCCTTACAGACTTGCCCAAGAGTCCTCATTCTGAGATCTTTCTAGAAGGGCAGAGCCTCAGCAACGTCCTTGAATAAGTAGGAAGCCCCTGGCATGAGT

TCCTAGCTGCTAATGTGTAGGTTACCAGAGTCTGCTCCTGCCTTGGCCCCATCATCCTTTTCCTGCCTTCTGGATTGTCCCCTTCCAAGATGACCTGCCA

TAGCTAAGGATAAGGACCCAAATTAAGCCGGTCAAAATTCTGATCTAACCGTTTGCCCCAGGAAAACAGACCCAGTCTGGCATGTTCATCCATGCAACTT

CCTTGATAGGCTCCTAAGTTCTATGAACACTTGGGAGCCTATTGTCCATGTGCATTTGGACATAAGGACACGTTTTTCTCTAACTTACATGAGAACCACA

TTCAATACCATCCATGAGAATTCTCAGGTCCCTGTACTACACACACAACCCCCAGGACAGTGCACCAAGTCAGGGTTAGGGTTAGAGTGAGGGTCAGGCC

TGGCCAGACATCTGGCAGTTTCTCCTGAGAGAAGTGGGCAACAGATAAATCTTGGAGTCAAGATTTCCCATTGGATTTTGTTTTTTTAAAGTCTCTTAGA

AATGCATTTGAAACAGTGTGTTTGTCTTTTCCCTTCTAGTTAAGGGACTATTTATATGTGTATAGGAAAGCTATCTCTTTGCTTTTCTTATTTCTCTTTC

AGTGAGGTCCAAAGAAAGATGCAAAAAGAAATGCTGCCTTTCCCATCCCATCCCATAATGTCACCTCAGACTCACATACACGCTGAGCATCTACACTGGG

TCATCGTGGAGTCATTATTTATTGAGTTACTGAGACACGCAGAGACAAGTCCACCATCCACTGTTTGTTTGGATTACCTTTCCTCCTCCTTGATGCCCAG

CCAGTCCTAGTGCATGCCACCACCACGCACCCCCACCAACCAGGCAATAATGGGTAAACCATACTAACTAGGGACAAAACTGGAACCAGATGGTGCCACC

TCAGGCAGCTGCCACCCATTCAAAGCATTTTTCCACTGCTAACAAAAGTTTCAATAACCTGTTCGATGCTAATTAAAAGGGAGCCTGCAGGGAGCAGGGA

TGAAGTGGCCTTCAGTGATGTTGTACTGACTTCCTTTTTAACCAAATCCAAAGTAGACTGCAGGAAAGGTAACTAGCCACTTGGGGTTTTGTTTGGTTTT

GGTTTTGTGTAAATAAGCCTAGCTGTTTGCTTTTTTCATTGTTAAAATAGAAATTGAGTTGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTG

TGTAACCCAATGAAGAAAGAACCTGGGTGGCAGACAGAGCTTTTCTGGCTGCACATCTCATCCCAGTGAGTCAGAGTCGCTCTTCCCTTCCTTTGATGGG

TCCCCGCTTCTTTTTGGTGCTCTGAAAGTTGTCTGGAGGAAAGGATTCTAATTTTAATTAATTGTGCAGTGAGCTAATCTCAGGAGCTTTTCTGCTTCAA

GGCATTTTAGGGAAAACAAATGGTTTTAGTAGATAAGGAGAGCCTATTAATGTTGGGGTTTTGTTTTGTTTCCAAACAAACACAGGAACATTTTTTTACT

ATAGATTTGGTTTTTAATGGATTTTTTTAAAATAATAATCATAAGATAGCAAAGCTCGGGGACATGGGGTTTTTTCCCCCTGATTTTTTCAAGATACCAA

GTAAGTGGCTAACAATATTTTTTTTAATTCGTTCCAGTCAGGATTTTTTAAATACTATATTGCCTAATTTACACCAGCCAAAAAACTGCCTCTTCTCCAT

TGTCTCTCCTCCTGTAAGATCAACACTTCATTTTTAACACTACACTAGATTCACTGTGGTTGGAACTCACTGCCTAACTTAACTCCCTCTACCTTGTAAT

TGATGATTGTTTTTGAAATGCAACTAAGATATTAATAAATAGCGTGTGATATTCAAAGTTATATAAACTGGAAGGTTGTATGTGGTTGCTTCTTGTTTTT

TTGTTTGTTTTGTTTTTTGAATTGGCCCATTTTTTAAAAAAAATTTTATACTCTCAAATAAACTTTCAGTTTCATTCTT
Translation
MWLLGPLCLLLSSTAE - UNI12843 - - UNI29572 - ESQLLPGNNFTNECNIPA - UNI16355 - AKAKSKCGPTFFPCASGIHCIIGRF

RCNGFEDCPDGSDEENCT - UNI22106 - TANPLLCSTARYHCRNGLCIDKSFICDGQNNCQDNSDEESCESSLE - UNI1240 - EPGSGQVFV

TSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGVQYVATQAEQNASEVGSPPSYS

EALLDQR RPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSAYSASSQAASSLLSVEASSHNPEQPGSPEGSAEPRDSVPSQGTEEV
Transcript ENSMUST00000057414
Sequence
ATTTGGGATTTTGCACCAATTTGT - UNI12843 - - UNI29572 - ACCATCTGTTCTCTCTCTCTCACAGAGAGCCAGCTGCTCCCTGGGAACA

ACTTCACCAACGAGTGCAACATCCCAGGTAACTTCATGTGCAGCAACGGGCGGTGCATCCCGGGCGCCTGGCAGTGTGACGGGCTGCCTGACTGCTTCGA

CAAGAGTGACGAGAAGGAATGCC - UNI16355 - CCAAAGCAAAATCAAAATGTGGCCCGACCTTCTTCCCCTGCGCCAGTGGCATCCACTGTATCA

TCGGCCGCTTCCGCTGCAATGGATTTGAGGACTGTCCCGACGGCAGCGACGAGGAGAACTGCA - UNI22106 - CAGCGAACCCCCTGCTTTGCTCC

ACGGCTCGCTACCACTGCAGGAACGGCCTGTGCATCGACAAGAGCTTCATCTGCGATGGTCAGAATAACTGTCAAGACAACAGTGACGAGGAGAGCTGCG

AGAGTTCTCTAG - UNI1240 - AACCAGGCAGCGGGCAGGTGTTTGTGACCTCGGAGAACCAGCTTGTGTACTACCCCAGCATCACGTACGCCATCA

TCGGCAGCTCTGTCATCTTCGTGCTGGTGGTGGCCCTGCTCGCACTGGTCCTGCATCATCAGCGAAAGCGAAACAACCTCATGACCCTCCCTGTGCACCG

GCTGCAGCATCCTGTGCTGCTCTCTCGCCTGGTGGTCCTGGACCACCCTCACCACTGCAACGTCACCTACAATGTCAATAATGGTGTTCAGTATGTGGCT

ACCCAGGCTGAACAAAATGCCTCGGAAGTAGGCTCTCCACCCTCCTATTCAGAGGCCCTGCTGGACCAAAG ACCTGCATGGTACGACCTTCCTCCACCA

CCCTATTCATCTGACACCGAGTCTCTGAACCAAGCTGACCTGCCTCCTTACCGCTCCCGGTCAGGAAGTGCCTACAGTGCCAGC CCAGGCAGCCAGCAG

CCTCCTGAGTGTGGAAGCCAGCAGCCACAACCCAGAGCAGCCTGGCTCTCCAGAGGGCTCTGCTGA
Translation
IWDFAPIC - UNI12843 - - UNI29572 - TICSLSLTESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECP - UNI1

6355 - PKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCT - UNI22106 - TANPLLCSTARYHCRNGLCIDKSFICDGQNNCQDNS

DEESCESSLE - UNI1240 - EPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHH

CNVTYNVNNGVQYVATQAEQNASEVGSPPSYSEALLDQR RPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSAYSAS PGSQQPPECGSQQPQPRAAWL

SRGLC

For any suggestions or comments, please send an email to unitrap@crg.es