Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048076 (Arf1)
Chromosomal location
Chr 11: 59024998 - 59041718 (-)
Description
ADP-ribosylation factor 1 Gene [Source:MGI (curated);Acc:Arf1-001]
RefSeq_dna
NM_007476 
RefSeq_peptide
NP_031502.1 NP_001123880.1 
UniGene
Mm.391127 Mm.469635 
MGI
MGI:99431 
Uniprot/SWISSPROT
P84078 
Human Ortholog
ENSG00000143761 (ARF1)
Omim not available
UniTrap UNI10213
Vector Insertion
Chr 11: 59027026 - 59041674
Public Clones (sanger) LST012 (baygenomics) P078E03 (ggtc) P099F10 (ggtc) P143D03 (ggtc)
P119A12 (ggtc) P011D05 (ggtc) P123F04 (ggtc) P149A12 (ggtc) 5SP121D04 (ggtc)
Private Clones OST234793 (lexicon) OST223685 (lexicon) OST123194 (lexicon) OST119254 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21982
Vector Insertion
Chr 11: 59026448 - 59026644
Public Clones not available
Private Clones OST312178 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061242
Sequence
GTGGGAGCGAAACCAACGCCTGGCTGGGAGCAGCCGCCGCGGAG - UNI10213 - GTCTTTGGCCAGTATCGATTCCACCTGTCCACAAACATGGGG

AATATCTTTGCAAACCTCTTCAAGGGCCTTTTTGGCAAAAAAGAAATGCGCATTCTCATGGTGGGCCTGGATGCTGCAGGGAAGACAACAATTCTATACA

AACTTAAGCTGGGCGAAATTGTGACCACCATTCCCACCATTG GTTTCAATGTGGAGACTGTTGAATACAAGAATATCAGCTTCACCGTGTGGGATGTGG

GCGGCCAGGACAAGATCCGGCCGCTGTGGCGCCACTACTTCCAGAACACCCAAG - UNI21982 - GCTTGATCTTCGTAGTGGACAGCAATGACAGA

GAGCGTGTGAACGAGGCCCGTGAAGAGCTCATGAGGATGCTAGCTGAAGATGAGCTCCGAGATGCTGTTCTCTTGGTGTTTGCCAACAAGCAG GACCTC

CCCAATGCCATGAATGCGGCCGAAATCACAGACAAGCTGGGGCTGCACTCTCTACGCCACAGGAACTGGTACATTCAGGCCACCTGTGCCACCAGCGGGG

ACGGGCTCTATGAAGGACTAGATTGGCTGTCTAATCAGCTCCGGAACCAGAAGTGAACCAGACCCCTCCCTCCCCCTCACTTCCTCTTCTCCGCCCTCAG

CTTTCCTCTCATGTGGCAAACGTGCGACTCTGTGGTCCTGAGTGCCAGAAGCTGTCTCCATGGGTTGGTCACAGTGTGCATCGCACCGTGCTGTACATGT

GCAGACGCAGCCTGCAGCCAGGTTTTTATTTAATGTAAATAGTTTCTGTTTCCACTGAGGCAGTTTCTGGTACTCCTATGCAATATTACTTAGCTTTTTT

ATTGTAAAAAGAGAATCAACTCAACTGTCAGTACTGAGAAGGGATTTGGGTGTAGGGGCACCTGGCCTCCGGGAGCCATTGGGCTGTAGACTGGTGTCGG

TATCCATTTGGTGGTTGGTTTTTAACCCAAACTCAGTGCATTTTTTAAAAATAGTTAAAAATACAGGACAAGAACACTTGAACACACAGAACGGAGACTA

TGCCTAGTGTAGGTTTTGCAGTTAATGGCCTGAATGCTAGATATCAGATCACCTGTTTCGCTGTGGGAACAGGAGAGAAGGTGATGAACAAACCACCATC

CGCTGCATGGTCACAGTAGAGCCCCCGTGACTCGCCTGTCTTTGGGTCACCTGCATTCCATAGCATTGTGCTTGTACTTGTGCTCACACGGTTACCTAGG

GTAGGCTGGGAGCCATTGTGGGGTGCAGGGCCTGGCTTGTACTTGGTGTGTGCAAGGCCCAATGGCAGCCTGCATACCCAGCCTACTCTTGGGCCCACTT

GGACGCGCTGGCAGGAGGCCTGGGTCTCACCAGCAGGAGTGCGTGCAAGGTGGGAGGGTCGGTCCATTACAGACCCACATCCTGGAGCACCCCCATCTCC

ATGTGTGAAGTAGCTTCCTCCCTCAGCCTGCAAGGGTCCGATTTGCCATCGAAAGACGACCTCTACTTTTTTCTTTTGTATTTTGATAAACACTGAAGAA

GCTGGAGCTGTTAAATTTATCTTGGGGAAATCTCAGAACTGGTTTATTTGGTGTCGTGGAACCTCTTACCGCTTTCAATACACAATTAGTAATC
Translation
 - UNI10213 - MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG GFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQN

TQG - UNI21982 - GLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQ DLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYE

GLDWLSNQLRNQK

For any suggestions or comments, please send an email to unitrap@crg.es