Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048096 (Lmod1)
Chromosomal location
Chr 1: 137221390 - 137264642 (+)
Description
leiomodin 1 (smooth muscle) Gene [Source:MGI (curated);Acc:Lmod1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37573
Vector Insertion
Chr 1: 137221848 - 137260246
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059352
Sequence
ACTAGCAGGGAGGCTGCTGTGTCCCCCGGAGCACCTGTAGTACAGCAGGGCCCAAAGAGCTGCAGTGCTCACCTAGCTGGGGCTTTGCGCTCAAACCCAC

TCAATACCAACAGGAACCAGGGCTCCCGTCCCTTCCCTGCCTACTACCACCAGCAAGCCCACCACACTTGGTAGGAGCAGCTGCTCACTTTGCCAAGATG

TCCAAAGTAGCTAAGTACCGGCGGCAGGTGAGTGAAGACCCCGACATCGATAGCCTGCTGTCCACCCTCTCCCCTGAAGAGATGGAGGAGCTGGAGAAGG

AACTAGATGTGGTGGACCCAGACGGGAGCATCCCGGTGGGGCTGCGGCAGAGGAATCAAACGGACAAACAGCCCTCGGGCTCATTCAACCGGGAAGCCAT

GCTCAACTTCTGTGAAAAGGAGAGCAAGAAACTCATCCAGAGAGAGATGTCTGTGGAT - UNI37573 - GAAAGCAAGCAAGTGGGGAGGAAGACAG

ATGCCAAGAATGGAGAGGAGAAGGACAGCGATGCCAGCAGAAAGGCCCCAGGCCCCAGACAGGACTCAGACCTGGGCAAGGAGCCGAAGAAGGGCGTTTT

AAAGAAAAGCTTCTCCAGGGATCGAGAGGAGGCCGATGGCAGAGGGGGTGAGAAGCCCAAGGAGGAGAAGGTCATCAGAGGTATTGATAAAGGCAGGGTC

AGGGCTGCGGTGGACAGGAAGGAGTCTGGGAAGGATGGCAGAGAAGAGAGGGCAGCCGCTGCAAGGAAGGAGGAAGAAAAGACAGGGAGTGTCAAGAACG

CAGGTCTGAGCAGAGACAAAGACAAGAAGAAAGAAGAGGTGAAGGAGCCCAGCAAGAAAGAGGAGGTGAAACTGACAGCAGAGAGCAGAAACACAGTCGG

GAGACGGGAGGACGGGAGGCTGAAAGAGTCAAGCAAGGAGAACAAGAAACCAGAGGATGAGGGCATAGGTTCTGGGGGCAGAGACTGGAGAAAAGAGGAT

GAAAAAGTTAAGAAGGAAGAAAACCAACCTGACAAAGAAGTCAGGGAAGAGAGCAAGACCAAAGCCCCGGAGAAACAGGCGCCCAGTTGCCCCAACAAGC

CCTCTGATGGGCAAGCCAGAGCAGAAGAGGAAGCAGCTCCCAGCATATTTGATGAACCTCTGGAGAAAGTGAAGAACAACGACCCAGAGATGACAGAGGT

GAACGTCAACAACTCAGACTGCATCACCAACGAGATCCTGGTCCGCTTCACAGAGGCCCTGGAGTTCAACACTGTGGTGAAGGTGTTTGCCTTGGCCAAT

ACTCGGGCTGACGACCATGTGGCCTTTGCAATTGCTATCATGTTAAAGGCCAATAAGACCATCACCAGCCTCAACCTGGACTCCAATCACATCACTGGCA

AAGGCATCCTGGCCATCTTCCGGGCCCTCCTCCAGAACAACACTCTGACAGAGCTGCGCTTTCACAACCAGAGGCACATCTGTGGGGGCAAGACTGAGAT

GGAGATCGCCAAGCTGCTCAAGGAGAACACCACCTTGCTCAAGCTGGGCTACCATTTTGAGCTGGCAGGACCCCGGATGACTGTCACCAATCTGCTCAGC

CGAAACATGGACAAGCAGCGACAGAAACGGCTGCAAGAGCAAAAGCAGGCCCAGGAAGCCAGTGGAGAGAAGAAGGACCGGCTGGAGGTACCCAAGGTCG

GGGCTCTGGCCAAGGGCTCCCCCAAACCTTCACCCCAGCCATCTCCAAAGCCTGCTCCAAAGAACTCACCCAAGAAAGCAGGTGTTCCAGCAGCCCCGCC

TCCCCCTCCCCCTCCCCTGGCCCCGCCCCTTATCATGGAGAACCTAAAGAACTCACTCTCACCAGCTACCCAGAGGAAGATGGGAGACAAAGTGCTCCCT

GCCCAGGAGAAGAACTCGCGTGACCAGCTCCTGGCTGCCATCCGTTCTAGCAACCTTAAGCAGCTGAAGAAG GTAGAGGTGCCCAAGCTACTTCAATAG

GACAGGCAGCCGGGCATTGGTACCAATGCCATGACTGCCCAGACTCTTGTCCCAGGGCTACACAGACCCCCACCACCCCACCCTGGCTGAGCTGTTGCAG

CTGTCCCTGTCCACCATGGGAGAGCATGAGACCTGGACCACGCTCGAGGGAGGACACCTCATCTCTTCTCCCTTTCCTTTTCTTGTCTCTGAGGCCCTTC

AAAAATTGCTTTGAAACCTGGAGCTGAAGTGTCCGGACAAGAGGAGTCCTTTAAGCACGTCACAGAGAAGATGGCACTGCCCAGAGCCCATGTAGCAGGC

ATGCTGCCAAAGGCTTATGATGCAGAAAAGATGTCTCCCAGGGACCACATTTGGACCCCAGCCTCACTGTCCCCAGGGCCAGGATTCAGGTCTCTGAGGA

GCCCTTGGGCAAAGTTGCTGGGCCAGTGGCACTCTATGGGACAGTGGTAGAGGCTGGAGGGGATGAAAGTCCAAAGGCAAAGTAGGAGGGCAGAGGATAC

TACAAACCCTCCACCTGATATGCCTGGGCAGCAGGCATGGTTGGACAGTGCCTGAGAGAGGGTAGGCTCCAGATGGGAGTAGAAAGACAGACAGACAGCA

GCTGGACCTGAAGGGTTGATGCCAAAGCAGACATTTTCTTCACATCACCTGCTGCTGTATAAATAGCTATATATCTGTTTTTCCATAAGATTTTGATAAT

ATATACAAACCTTTAGCTTCAAGTGGCTATACCTCACCTTTTTTCATGTTAATGGTCCTAATGTTCCCAATGGTCCCAGGTTCCCTAAAAGGCCTCCCAA

AGCTCAGGGTCCCTGGCAAGCCATTCAAGGTGACAGTAGACATCATCCCTAGAGTCCGTGTACCACTACAGAAAGGGCAGTCTGGGGGGAAGCTTGAATT

CTTGAGACAACCTTGTGACCTGGTGTTCCAGGTCTGTTCCTCAGCCAGTCTCTCTGCCTCGTATCTGTGCCCAGAACTGTTCTCAGGGGCTGAGAGTCAC

ACAGGGCCCCGGGATGGCTATATTAGGCACGTTCAGGAATGATCATTCCGTGACTCTTCCTACTGTAGGCTCAGGGCCAGCTCTTCACAGCAGTTACAGG

CGAAGGAAGGCAGAGTGAGTCAGAGTGACTCAGGGAAGGACAGCTCCTGCACCCAGTGTGACTTAGGGCCAGAGGTACCTCTCCACCCCCAGCATCCCCT

GCTGGAGGCAGAGCCACCACAGCCATCACCGGGGGTACATGGAATACTGTCCCAACTAGGGATGAAACTCAGAGTCAGGTTCCACGCCCAGCACAGAGGC

CCTGTTTTCCATCCCCGGCACGATTTCTTTCTGATTTACTGCCCTGACGGTAACTGTGCCACCATGAAACTGCCACCTTGGTTCTGGGTCACAGACAGGT

GCTCTGCCTTTTTGTTTCTCTTTTTGTTTCTTTTTTTCTTTTTCTTCAGTTAGCAGAGAGCAAAGCCATTGGAATATGGGTGGGGTCCCACCTCCCTAAG

GAAGTAGGGTAGCTGTTATAGGGTCTGGCTCAAATCAGAGAGGGCTAACTCATATCCCAGGGTACACTCTGATCCCATTCCTTCCCAACCCGTCTATCTA

CTGCTCAAGTAATGGGCTGGCCCAGGGGAGGAGAGATACCAGCGCTGGTTCCCAGATCGCAAAGAGTATGCTTTGGAGTCAAGCCCATGAGCTTTCATCT

GATGGTGCAGGGCACTAGCTAGATGCTTAAGGGTGCTTCTGCTTATCTTCCAACTCTGTGATGTGGAAGCCAATCGCCTCGATGTTTTGCAGATAGAGTT

AATCAGCTGCACGTGGGTACATGACGAATAAGAGGTAGGGCTGAGGTCTTAACTCCTCTCTGCTGCTGAAAAAACGGACCAGTGATAGTTTTTCACAATG

ACATTGGAAGCCAAATGGAACTAGTTTTACATATATAAATATATAATTTCCTCTTTT
Translation
MSKVAKYRRQVSEDPDIDSLLSTLSPEEMEELEKELDVVDPDGSIPVGLRQRNQTDKQPSGSFNREAMLNFCEKESKKLIQREMSVD - UNI37573 -

 ESKQVGRKTDAKNGEEKDSDASRKAPGPRQDSDLGKEPKKGVLKKSFSRDREEADGRGGEKPKEEKVIRGIDKGRVRAAVDRKESGKDGREERAAAARK

EEEKTGSVKNAGLSRDKDKKKEEVKEPSKKEEVKLTAESRNTVGRREDGRLKESSKENKKPEDEGIGSGGRDWRKEDEKVKKEENQPDKEVREESKTKAP

EKQAPSCPNKPSDGQARAEEEAAPSIFDEPLEKVKNNDPEMTEVNVNNSDCITNEILVRFTEALEFNTVVKVFALANTRADDHVAFAIAIMLKANKTITS

LNLDSNHITGKGILAIFRALLQNNTLTELRFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQKQAQEASGE

KKDRLEVPKVGALAKGSPKPSPQPSPKPAPKNSPKKAGVPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLK

K VEVPKLLQ

For any suggestions or comments, please send an email to unitrap@crg.es