Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048249 (A930001N09Rik)
Chromosomal location
Chr 17: 26852595 - 26909832 (+)
Description
RIKEN cDNA A930001N09 gene Gene [Source:MGI Symbol;Acc:MGI:1924378]
RefSeq_dna
NM_029870 
RefSeq_peptide
NP_084146.1 
UniGene
Mm.390978 Mm.468580 
MGI
MGI:1924378 
Uniprot/SWISSPROT
Q8CDG5 
Human Ortholog
ENSG00000164463 (C5orf41)
Omim not available
UniTrap UNI4582
Vector Insertion
Chr 17: 26852720 - 26873733
Public Clones XT0125 (sanger) YHD319 (baygenomics) (egtc)
Private Clones OST260280 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35325
Vector Insertion
Chr 17: 26873929 - 26876487
Public Clones IST11637D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26453
Vector Insertion
Chr 17: 26894945 - 26896704
Public Clones not available
Private Clones OST116859 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062519
Sequence
GAGTCACGCGATTTCCGGGAACCCGTCAGGAAGGACATAAACAAAACAAACCGAGGCAGCATGGAGACGGCCCGCGGCCGCGTAAGCGCGGCCGGATCCA

GTGCCTGAACCGCCTTCAGCCTCAG - UNI4582 - AACCGCAAATTTATTTTTTTTAAAAAGTGGTGACCCAAGCAGTTGAACTGAAGGTATTCTGG

GAAAATCTGCTGTTTATTGTGAAAATCATCTTTGATCTTGGAATTAAAAGTAAAGCTGGAAAGGAATTTACAAACAAGAAAAAGAAGAAGTTTGGAATTG

GACTCACAGGATCTGGGCTTGGAAATGCCTCAG - UNI35325 - CCCAGCGTAAGCGGAATGGACCCGCCTTTTGGGGATGCCTTTCGAAGCCACAC

CTTTTCAGAACAGACTCTGATGAGCACAGATCTCTTAGCCAACAGTTCTGATCCAGATTTCATGTATGAGCTG GATAGAGAGATGAATTATCAACAGAA

TCCTAGAGACAACTTCCTTTCTTTGGAAGACTGCAAAGACATTGAAAATCTGGAGACTTTCACAGATGTCCTGGACAATGAGGATGCTTTAACTTCAAAC

TGGGAACAGTGGGATACATACTGTGAAGACTTAACTAAGTACACGAAGCTCACCAGCTGTGACATTTGGGGGACAAAAGAGGTGGATTACCTGGGTCTTG

ATGACTTTTCTAGCCCTTACCAAGATGAAGAGGTCATCAGTAAAACTCCAACACTGGCCCAGCTCAATAGTGAGGACTCTCAGTCTGTTTCCGATTCCCT

TTATTATCCTGACTCACTCTTCAGTGTCAAACAAAATCCCTTGCCCCCCTCCTCTTTTCCTAGTAAAAAGATCACAAATAGAGCAGCTGCCCCTGTGTGT

TCTTCAAAGACACTTCAGGCTGAGGTCCCATCATCAGACTGTGTCCAAAAAGCAAGCAAACCTACTTCAAGCACACAGATCATGGTGAAGACCAACATGT

ATCATAATGAAAAGGTGAATTTTCATGTTGAATGTAAAGACTATGTAAAAAAAGCAAAAGTCAAGATCAACCCTGTGCAACAGGGCCGGCCCTTGCTGAG

CCAGGTCCACATAGATGCAGCAAAGGAGAACACCTGCTACTGTGGAGCTGTGGCAAAGAGACAGGAGAGAAGGGGGGTGGAGCCGCATCAGGGTCGGGGC

ACTCCTGCTTTGCCTTTCAAAGAAACCCAGGAGCTATTACTTAGTCCTCTGACGCAGGATAGTCCTGGGTTGGTTGCCACAGCAGAGAGTGGCAGCCTTT

CTGCCAGCACTTCTGTTTCAGATTCATCCCAGAAAAAAGAAGAGCACAATTATTCTCTTTTTGTCTCTGACAACATGAGAGAACAGCCAACCAAATACAG

TCCTGAAGATGATGAGGATGATGAAGATGAGTTTGATGATGAGGACCATGATGAAGGGTTTGGCAGCGAGCATGAGCTTTCTGAAAATGAAGAGGAGGAA

GAAGAGGAAGAGGATTATGAGGATGACAGAGATGATGATATCAGCGACACGTTCTCTGAACCAG GTTATGAAAATGACTCTGTAGAGGACTTGAAGGAG

ATGACGTCCATATCTTCTCGGAAGAGAGGGAAAAGAAGGTACTTCTGGGAGTATAGTGAGCAGCTTACACCATCACAGCAAGAGAGGATTCTGAGGCCTT

CTGAGTGGAATCGAGATACCTTGCCAAGTAATATGTACCAGAAAAATGGCTTACATCATG - UNI26453 - GGAAATACGCAGTGAAGAAATCACGG

AGAACTGATGTGGAAGACCTTACTCCAAACCCTAAAAAACTACTTCAGATTGGTAATGAGCTGCGCAAGCTGAATAAGGTGATCAGTGACCTGACTCCAG

TTAGTGAGCTTCCCTTAACAGCAAGGCCAAGGTCAAGGAAAGAAAAAAATAAGCTGGCATCCAG AGCTTGTAGGCTAAAGAAGAAAGCCCAGTATGAAG

CTAATAAAGTGAAGTTGTGGGGCCTCAACACTGAATATG ACAATTTATTGTTTGTAATCAACTCCATCAAGCAAGACATTGTAAACCGAGTTCAGAATC

CAAGAGAAGAGAGAGAACCCAGCATGGGGCAGAAGCTTGAAATCCTCATTAAAGATACACTGG GTCTCCCAGTCGCTGGGCAAACCTCAGAATTTGTTA

ACCAAGTGTTAGGGAAGACTGCTGAAGGCAACCCCACTGGAGGCCTTGTAGGACTAAGGATACCAGCATCAAAAGTGTAATCAGCCTCATTGGACCACTG

GTCAGAAATGTCTGTTTTTGTCATGTTATCCATTGTAAATTTTCATTCTGTTTTGCATGTCAATTAGCATTATGTAAACATTTATAATTAGGTTACATTG

TTTTAAAAACAATAGCATAAGTGAAGCATGATCCAAAATACTTGATTATTGCATTTTCAGAGCATAAACCAGTGACCCTGCTGCTGGCATGAGAAAGAAG

CTCACACATTAAGTAAATATGAGGTACAGATTGTAAACATTTGTTGAAGCAGAGTGTTTTGGGTGAGTGAATATATTAGTATAATGCTGAGTGTTAAGGT

GGGTTTATGCTCTGAACCACACAAAAATACCGAGGAAGCATTTTTTTTCAAAGTCCATTTAGATTGTTTTTAGAATGACTGCTTTTTGTTCTAATTTTTT

ACAGCCATTAATCTCACATGTACATGGCGCACCCAGCACTCACGTGTGTACCATGTTTAGATGTTTTTCAGAACTCAATATGATATATAAAAATACATAT

ATATATATATATATATATACATACATATATATATATAGAATTGTCTGTGCAAGTAAGAAAAAGCATACTCTTTGTGCCTTGTATTTTGGGGAAACTCTAA

AACTGGTAATATTTTGTATGATGAAAATCCTAATGAGGAAAACCAAGATATATAGATGAGAAAATTATGGGGTTTAAATGTCTTTTTGTTCCAACTCTTT

TTCAGATTTTTTTGAATGTATATAGGACTATGTCAAAATGTAGATATATGCCACAGAGTCTGTGTATTGTATAAAAAAAAAAACAAAAAACAAAAACAAA

CAAAAAAAGATGGCTCTAGAGAACTCCTATTTCGGTACTTGACCGGAAGAAAATACTTGCACATTATTGCGATTGTTTTATTTTTTCTACCAAAGACAAA

TGCAACTGGTATGGCAGACTGCCAGTCTAAGTAAAGTTTTGCACAGCTTACATGATACTGTATGAATGTATGAAACAGAGAAAAAATTAAAAGGTCAGGG

TTAGGGATCTTACTCAACTGTGAACTTTATTTCTGTTTGGGTCCAATTATCTACAGAAGGAGCATCCATACATCCAAATATTATTTTGCTGTCCTCTAGT

TTGCTTCCATAGTAGATAAGTTGGTGGCCACTTAGGTGTCTTTTATTTCTGCAGTTATTGTAGGAAATTTTAATATATTTCATATTAGTAAGCTATTGAT

AAAATAGTTTTTGACTTTGAAAATTAAAGTTTATTTAGCTTATTGTAGTATACTTCCACCAAACAACCAAAATACAGATTATTTTTATCGTATTATGTAT

ATATATATGTAAAGAGATAAAAAAGCTAAAAATATCTAATACTTTAGTTGCCACTTTTCCAATTGATGTTATTGTGCATGTAATATTTTCAAAGATCAAC

ACAAGCTTAAAACAAATTTATAAATTTTTATATTTTTGTACAGGTATTTTCTTCAAACTT
Translation
 - UNI4582 - MPQ - UNI35325 - PSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYEL DREMNYQQNPRDNFLSLEDCKDIENLE

TFTDVLDNEDALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGLDDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPPSS

FPSKKITNRAAAPVCSSKTLQAEVPSSDCVQKASKPTSSTQIMVKTNMYHNEKVNFHVECKDYVKKAKVKINPVQQGRPLLSQVHIDAAKENTCYCGAVA

KRQERRGVEPHQGRGTPALPFKETQELLLSPLTQDSPGLVATAESGSLSASTSVSDSSQKKEEHNYSLFVSDNMREQPTKYSPEDDEDDEDEFDDEDHDE

GFGSEHELSENEEEEEEEEDYEDDRDDDISDTFSEPG GYENDSVEDLKEMTSISSRKRGKRRYFWEYSEQLTPSQQERILRPSEWNRDTLPSNMYQKNG

LHHG - UNI26453 - GKYAVKKSRRTDVEDLTPNPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASR RACRLKKKAQYEANKVK

LWGLNTEYD DNLLFVINSIKQDIVNRVQNPREEREPSMGQKLEILIKDTLG GLPVAGQTSEFVNQVLGKTAEGNPTGGLVGLRIPASKV

For any suggestions or comments, please send an email to unitrap@crg.es