Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048264 (Dip2c)
Chromosomal location
Chr 13: 9276228 - 9668171 (+)
Description
DIP2 disco-interacting protein 2 homolog C (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1920179]
RefSeq_dna
NM_001081426 
RefSeq_peptide
NP_001074895.1 
UniGene
Mm.401097 Mm.217326 
MGI
MGI:1920179 
Uniprot/SPTREMBL
Q8CBE5 B2RQ71 Q5EBR0 Q69ZV2 Q6NY04 Q6PGL8 
Human Ortholog
ENSG00000151240 (DIP2C)
Omim not available
UniTrap UNI31282
Vector Insertion
Chr 13: 9276313 - 9492350
Public Clones 5SE223E08 (ggtc) 3SE223E08 (ggtc) 5SD063G01 (ggtc) IST11585H8 (tigm)
IST11717A11 (tigm) IST13027A1 (tigm) IST14752G8 (tigm) IST14739E9 (tigm)
IST12607B12 (tigm) IST11960F7 (tigm) IST12280H10 (tigm) IST13333A9 (tigm)
IST12332F1 (tigm) IST10950F2 (tigm) IST14742G5 (tigm) IST10659B12 (tigm)
IST13415B4 (tigm) IST12416E3 (tigm) IST12236E8 (tigm) IST14809G5 (tigm)
IST14716E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23665
Vector Insertion
Chr 13: 9492423 - 9505824
Public Clones not available
Private Clones OST250031 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5916
Vector Insertion
Chr 13: 9505824 - 9505936
Public Clones CSH142 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27285
Vector Insertion
Chr 13: 9505936 - 9532497
Public Clones not available
Private Clones OST64998 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32383
Vector Insertion
Chr 13: 9574728 - 9576049
Public Clones IST14297B8 (tigm) IST12276F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14337
Vector Insertion
Chr 13: 9627350 - 9633967
Public Clones E080G08 (ggtc) FHCRC-GT-S18-7G1 (fhcrc)
Private Clones OST63964 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099913
Sequence
AGGTGACATTACACAAAAGGGATATGAAAAGAAGAGGTCAAAATTAATTGGAGCCTACCTTCCCCAGCCTCCAA - UNI5916 - - UNI23665 - 

GAGTGGACCAAGCTCTGCCTCAAGAGCGACGGGCGCCTGTCACTCCTTCCTCAGCTTCTCGATACCACCGCCGAAGGTCCTCAGGGTCTCGAGATGAACG

TTATCGGTCAG - UNI5916 - - UNI27285 - ATGTTCATACAGAAGCTGTCCAGGCAGCTCTTGCTAAACACAAAGAAAGGAAAATGGCAGTAC

CTATGCCTTCCAAACGAAGATCCCTGGTTGTACAGACCTCCATGGATGCCTACACTCCCCCAG ATACCTCTTCCGGTTCAGAAGATGAAGGCTCAGTAC

AGGGTGATTCCCAGGGAACCCCCACTTCTAGCCAGGGCAGCATCAACATGGAGCATTGGATCAGCCAGGCCATCCATGGCTCTACCACATCAACAACCTC

CTCCTCCTCCACGCAGAGTGGGGGCAGTGGGGCAGCACACCGGCTGGCAGATGTCATGGCCCAGACACACATAG AAAATCATTCTGCACCTCCTGATGT

AACCACCTACACCTCAGAACACTCAATACAAGTGGAAAGGCCGCAGGGCTCCACCACATCCCGGACAGCACCAAAGTATGGCAATGCTGAGCTCATGGAG

ACTGGGGATG GTGTACCAGTAAGTAGCCGGGTATCAGCAAAAATTCAGCAGCTTGTCAATACCCTTAAACGACCGAAGCGGCCACCATTACGGGAATTC

TTTGTTGATGACTTTGAAGAATTGTTAGAAG TTCAACAACCAGATCCAAACCAACCAAAGCCAGAGGGCGCCCAGATGCTGGCCACAAGAGGGGAGCAG

TTGGGAGTCGTCACAAACTGGCCACCCTCTTTAGAAGCTGCACTACAACGATGGGGGACCATCTCCCCGAAGGCCCCCTGCCTGACCACCATGGACACAA

ATGGAAAGCCCCTGTACATCCTCACTTATG GCAAACTATGGACACGAAGTATGAAGGTTGCTTACAACATTCTACATAAACTAGGTACAAAGCAAGAAC

CTATGGTACGGCCTGGAGACAGG GTGGCGCTAGTGTTCCCCAACAATGACCCTGCTGCTTTCATGGTGGCCTTCTATGGTTGCTTGCTGGCTGAAGTTG

TTCCTGTCCCCATTGAAGTGCCACTCACAAGAAAG GATGCAGGGAGCCAACAGATAGGTTTCTTGCTTGGAAGCTGTGGAGTAACTGTTGCCTTGACTA

GTGATGCCTGTCACAAAGGACTGCCAAAAAGCCCAACAGGAGAGATCCCACAGTTCAAAG GTTGGCCAAAGCTGCTATGGTTTGTCACAGAATCAAAAC

ACCTCTCTAAACCTCCTCGGGATTGGTTTCCACACATCAAAGATGCAAATAATGACACAGCTTATATTGAG TATAAGACGTGTAAAGATGGAAGTGTTC

TTGGTGTGACCGTGACGAGGATAGCGCTGCTGACACACTGTCAGGCACTCACACAGGCCTGCGGCTATACAGAAG CTGAAACCATTGTGAATGTTCTAG

ACTTCAAGAAAGATGTGGGGCTCTGGCATGGCATATTGACA AGTGTCATGAACATGATGCACGTCATCAGCATCCCATACTCGCTGATGAAGGTAAACC

CCCTCTCCTGGATCCAGAAGGTCTGCCAGTATAAAG CAAAAGTGGCTTGTGTGAAATCAAGAGACATGCACTGGGCACTTGTAGCACACAGAGATCAGA

GAGATGTCAACCTGTCCTCGCTGCGCATGTTAATAGTGGCTGATGGAGCAAATCCCT - UNI32383 - GGTCTATTTCTTCTTGTGATGCGTTTCTC

AATGTCTTCCAGAGTAAAGGCCTTCGACAGGAGGTCATCTGTCCCTGTGCCAGCTCACCAGAGGCCCTCACTGTGGCAATCCGGAG GCGTGGGTATGGA

AGGTGTTCAGAAA CCACCAGGACGAGGTGTGCTATCCATGCATGGGCTGACCTATGGTGTGATACGTGTGGATTCAGAGGAGAAGCTGTCCGTGCTCAC

AGTGCAGGATGTAGGCCTTGTTATGCCTGGAG CCATCATGTGTTCAGTGAAGCCAGATGGGATTCCTCAGTTGTGCAGGACGGATGAAATCGGGGAGCT

CTGTGTCTGTGCAGTTGCCACAGGAACATCATATTATGGTCTCTCTGGCATGACCAAGAACACCTTTGAG GTATTTCCCATGACAAGCTCCGGGGCTCC

GATCAGTGAATACCCATTCATAAGGACAGGTTTGCTGGGATTTGTTGGTCCTGGGGGCCTCGTCTTTGTTGTGGGTAAGATGGACGGCCTGATGGTAGTC

AGTGGAAGAAGACACAATGCAGATGACATTGTGGCCACAGCCTTAGCTGTAGAGCCCATGAAGTTTGTCTACAGAGGCAG GATAGCTGTGTTCTCAGTG

ACTGTCCTTCATGATGAAAGGATAGTGATTGTGGCTGAGCAGAGGCCGGACTCCACAGAGGAAGACAGTTTCCAGTGGATGAGCAGAGTACTCCAG GCA

ATTGACAGTATACATCAAGTTGGAGTTTATTGCCTGGCCTTGGTACCAGCAAATACCCTTCCCAAAACCCCACTTGGTGGCATCCATTTGTCAGAAACAA

AGCAGCTTTTCCTGGAGGGCTCCCTTCACCCCTGCAATGTCCTGATGTGCCCACACACCTGTGTCACAAATTTACCGAAACCTCGGCAAAAGCAGCCAG 

AAATTGGCCCTGCCTCAGTGATGGTGGGAAATCTAGTATCTGGGAAGAGGATTGCCCAGGCTAGCGGCAGAGACCTGGGTCAGATAGAGGACAATGACCA

GGCCCGGAAGGTGAGAACCGAG TTCCTGTTCCTCTCAGAGGTCTTACAGTGGAGAGCACAGACCACTCCTGACCATCTGCTGTACACTCTGCTCAACTG

TCGG GGAACAATAGCAAATTCCTTGACATGTGTTCAACTACACAAGCGTGCAGAAAAGATAGCAGTGATGCTGATGGAGAGGGGCCACCTGCAGGACGG

AGACCATGTGGCATTAGTCTACCCTCCAG GAATAGACCTTATCGCTGCATTTTATGGTTGCCTATATGCAGGCTGTGTGCCAATTACCGTGCGACCTCC

ACATCCACAGAACATTGCAACGACATTGCCTACAGTCAAGATGATCGTAGAG GTGAGTCGATCTGCTTGTCTCATGACAACACAACTGATATGTAAACT

GCTTCGGTCCAGAGAGGCAGCAGCAGCTGTAGATGTCAGGACATGGCCCCTCATACTGGACACAG ATGATTTGCCAAAGAAGCGGCCTGCCCAGATCTA

CAAACCTTCCAACCCTGACACACTGGCTTACCTTGACTTTAGCGTGTCCACAACCGGGATGCTAGCTGGTGTAAAG ATGTCTCATGCAGCCACCAGTGC

CTTTTGCCGTTCTATTAAGCTGCAGTGCGAGCTTTACCCTTCTAGAGAAGTGGCCATCTGCTTGGACCCTTACTGTGGACTTGGGTTTGTCCTCTGGTGT

CTCTGCAG - UNI14337 - TGTATACTCAGGACACCAGTCCATTCTGATCCCACCCTCTGAGCTGGAGACCAATCCTGCCTTGTGGCTTCTTGCTGT

GAGTCAATACAAAGTCCGGGATACCTTCTGTTCCTATTCGGTGATGGAGCTTTGCACGAAAGGGCTGGGCTCACAAACTGAGTCCCTCAAG GCACGAGG

CTTGGACTTGTCCCGGGTAAGAACCTGTGTGGTTGTGGCAGAAGAGCGTCCCCGAATCGCCCTTACACAGTCTTTCTCAAAGCTCTTTAAGGACTTGGGT

CTCCACCCACGAGCTGTTAGTACTTCATTTGGCTGCAGAGTGAACCTGGCAATTTGCTTACAG GGGACATCAGGACCTGACCCCACCACTGTCTATGTT

GACATGAGAGCCCTGAGACATGACAG AGTCCGGTTGGTAGAAAGGGGATCTCCTCACAGCTTACCTCTGATGGAGTCTGGAAAA ATACTTCCTGGGGT

CCGGATCATTATTGCCAATCCAGAAACAAAAGGCCCACTGGGGGACTCCCACCTTGGAGAG ATCTGGGTTCACAGTGCCCACAATGCCAGTGGCTATTT

TACCATTTATGGAGACGAATCTCTTCAGTCTGATCATTTCAACTCCCGGTTAAGTTTTGGAGACACCCAGACTATCTGGGCCCGAACTGGCTACCTGGGC

TTTCTTCGGAGAACTGAGCTCACAGATGCAAATGGAG AGCGCCATGATGCCCTCTATGTAGTGGGGGCACTGGATGAAGCCATGGAACTGCGAGGCATG

AGGTACCACCCAATAGACATAGAGACTTCAGTCATCAGAGCCCACAAAAGTGTCACAGAATG TGCTGTCTTTACCTGGACAAACCTGTTAGTGGTTGTG

GTTGAACTTGATGGCTCAGAGCAGGAAGCCTTGGACTTGGTTCCCTTGGTAACCAATGTGGTCCTGGAAGAGCATTACCTGATTGTAGGAGTAGTGGTCG

TGGTGGACATCGGGGTCATCCCCATCAACTCCCGGGGAGAGAAACAGCGGATGCACTTGCGAGACGGGTTCTTGGCAGACCAGCTGGACCCCATCTACGT

GGCCTATAACATGTAGTCTCATCGCTTTGACTTCCACAGACTTTTCTACGGACGGACGTGACCATTTTTCTTTCTTTTTTTTCCTTCTCAGTGTCCACAG

AGACATGCAGACACTCGGGCCACACTCAAAGGAGGAGCCTGATGCGGTGGGGTTTGGGGTAGTACTTCTAGGAGCAATCACCCTGGCATGGAGATGAAAT

GTGAATTTATGCTGGATTTTGCTCAGAAGGACTTTGGATCACTGCCTTCAGTTTGCTGGATAAGATCATTTTAAGAACTTTCTTTCCTTCCTTTTTTCTT

TCTTTTTTCTTTTTTTAATTATTGGATAAGAAGTGTTCTCTTCGTAAATGTGGTATTTTGTTAAGCCGAAATAGCAATTAAAAAAAAATAGTCTACCCTT

CAAATGGGTTCTTTTAAACAATTTATGTAGTGTGACAAGGAATTGTTTTTTCTGTTTTAATGTGTCATGGGATCTTACTGACATGGATCTGTTACTAATT

TAAGCCATCCCTAGATCTCACCCTTCTAGGAGAGTTTATTGAGGTACGAGAACCTTCCAGGTAGCACCTTCCAATTAGATTTTAGCAGCTTGCTTTGTCA

GAGACACGCTGAAGAAACAGAGGCCAGTTCATGGCCTTTGAAGTTAACATAGAAGGAGAAGTGATTATAAATAAGGTATTTCGGCAACTATCTTGCAGAT

ATCTTTGTACTAAACTAAAAAGATAAAAATAAGTTAACTTCCTCGATATGTAATTATGTACAAAATGTTTAATTTATTTTGATCTCTTTAGAAGTATAAA

AGAGAAAAAACATTCAAGAATATTAAAGTCTTGTAATGTTTGCTAATATAAAAAAAGTGTTGTATTATCTTGCGTGGATAGTATCACAACAAATATATAT

ATATGAAATATAAATTCACTAATGAACAAAGGAGATTTTAAAGTTTAACTGCAGAACTTGTCACTTGCATGGTGCGCCCTCCACTGTATCCACACACACT

TGGCTGTTTCCGAGCAATCGCAGATCGCCAGGAACCCTGTCTTAGACCCAAGACCAGCAAGTGGAGTCACCGCTGTCTCTGAGAGGGTGAAGGGATTCAA

TGCTAACATGCACTATTTTTTCCTTTGCTGTGAGGACGACAGTGAATGCTTTCCTGCCAGCATGTGCCAGTGACATTGAGGGGCTCCAGGTTGGCAAACA

GCACTGTTTTCTCAGCTGCAAGAATTTGTTGCATAGTGTCAATTTTATTTTAGCATTTTTGTGTCACATTTTATAATTTTTGTTGTTGTTGTCCCTTGAT

ATGAAGAGAATGACACCCTGTGGTCATTTGTACCACATTTGTGTCACTAATTTACCACTGCCAGTGGCCAATCTGAGCAGATAAATGACCAGAACGCCTT

TGAGGGAAAAGCTAGCTATATGTGATGTCTTCTCGACTGTGTAGACCCAGCCAACTCTGATCCTCCAATCTTGGGAACTCCCTAGCTTGGCCATGAGAGT

AGGCACTAGTCCAGGGACTTAAAACAGCAAGGAGTTCTGCCAGCATCATCCTTGTACTAGCCGTTGGGGAACTGATCCCTGGTCCCATGTGCCTATATTT

TCATGTGCACAGGTTAGCCACTGTATCCTTGTCTGTATCCAACCAAGGAGAAGATATCAACAATACAAGACAATGTTTATTTTGTAATTGCCACAGTATG

GCTTCAGTGGCTCCTAGTATGAGAGAAACCTAAAATTGTTATTCGGCAAAAATGAGGTTCCTGATTGCTTTATGGGCGAGGTCTTTGTCTGCCTTAGTTA

CAGCTGCCAACAGTAAGCCCTTTGCTAAAAGAGCGTTTTCTATGACTTCCGAGATCCAAGGCTCATTTGTTTTGGTTTGTTATTAATTTAAGTGGTACAT

TTCTTTTGAAAATTTACATGTGTAAAGCATTATTCATCTCCATAAATCACTTAATTTTTCAAATATTGTTTGCTCATTGCTATATGTTTCTGCATGTTTC

AAATACACATTCCTACAGTTTGCAGCTTCCCCAGGGGGGGAAATCCCTGCCACATACAGAAAGAATTTTCTTGATACATGCATTTGCACCCCCATACCTC

CCCCCCCCCCAGGGAACTTGGTTTAATGTTTCAGATAGTAGACTGATTGGTAAACATGATTACAGTGTGCAGGAAATCTTCCATCTGGCTAATGTGAGGA

AGCAAAGCAAATTTAGATGTCACTCAGAACCTACTCTTAACTTTTCACCATATCAACTTCACACCCAAGGAGGGCGAAGGCTGCAGCACAGGGGCAAAGC

CCATCCCAGCCGGTCTCTTCTGTACCCTGCCATCTGTCACGTGACGCTTTAGGTTTCAAAGAGTTGGTGGACTCGGTTGGAAGCTTAGTTGTGCAAGAAA

AAGGGAAGAAGACACTTAAGTACCACCAGTTTCAGCAATAAAGAAGGATCGTTGTGTATTAGAAACCGTACTGTAGATAAATCATTCATGAGAATGTTTT

TTAAAAAGAAAAATGTTTGTCTTGTGACCATGTGCTTTTGGAGTCAGCCAAAACCGTGTAATCAACTTGCACAAAAAGAGGGTACACAATGAACATTGAG

ACACAGACCTAATCAAACAGGAGCAGATTCCTCATGGTGCTTGTTTATTATATATATTTAACCCTGCTTGACACTTTACCCAAGGGGACGGTCCCTTTAT

CAGTTGAATGTTAGCAGCGTTATTTCAGAGTGTGGTGACTGGTTAGAGAAAACTCATGTACTCAACCAATCACAGTTTCAAACAAAATTTTTATGTGCAA

AGGACAGCAACCTTCTTGTATGTTCAACCACCAGTACGCTTTGTACATCTGTGATAACGCCTGTTTTATATTCAAATGAACAAATAAAAGCTTTTATTTT

TGTTGCTCTGA
Translation
 - UNI5916 - - UNI23665 -  - UNI5916 - - UNI27285 -              - UNI32383 -       MCPHTCVTNLPKPRQK

QPE EIGPASVMVGNLVSGKRIAQASGRDLGQIEDNDQARKVRTE FLFLSEVLQWRAQTTPDHLLYTLLNCR GTIANSLTCVQLHKRAEKIAVMLMER

GHLQDGDHVALVYPPG GIDLIAAFYGCLYAGCVPITVRPPHPQNIATTLPTVKMIVE VSRSACLMTTQLICKLLRSREAAAAVDVRTWPLILDTD DD

LPKKRPAQIYKPSNPDTLAYLDFSVSTTGMLAGVK MSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCS - UNI14337 - SVYSGH

QSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLK ARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGC

RVNLAICLQ GTSGPDPTTVYVDMRALRHDR RVRLVERGSPHSLPLMESGK ILPGVRIIIANPETKGPLGDSHLGE IWVHSAHNASGYFTIYGDESL

QSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGE ERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKSVTEC CAVFTWTNLLVVVVELDG

SEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM
Transcript ENSMUST00000062376
Sequence
ATGGCGGACCGCAGCCTGGAAGGCATGGCTCTCCCGTTGGAGGTGAGGGCCCGGCTGGCCGAGCTGGAGCTGGAGCTGTCGGAAG - UNI31282 - G

TGACATTACACAAAAGGGATATGAAAAGAAGAGGTCAAAATTAATTGGAGCCTACCTTCCCCAGCCTCCAA - UNI5916 - - UNI23665 - GAG

TGGACCAAGCTCTGCCTCAAGAGCGACGGGCGCCTGTCACTCCTTCCTCAGCTTCTCGATACCACCGCCGAAGGTCCTCAGGGTCTCGAGATGAACGTTA

TCGGTCAG - UNI5916 - - UNI27285 - ATGTTCATACAGAAGCTGTCCAGGCAGCTCTTGCTAAACACAAAGAAAGGAAAATGGCAGTACCTA

TGCCTTCCAAACGAAGATCCCTGGTTGTACAGACCTCCATGGATGCCTACACTCCCCCAG ATACCTCTTCCGGTTCAGAAGATGAAGGCTCAGTACAGG

GTGATTCCCAGGGAACCCCCACTTCTAGCCAGGGCAGCATCAACATGGAGCATTGGATCAGCCAGGCCATCCATGGCTCTACCACATCAACAACCTCCTC

CTCCTCCACGCAGAGTGGGGGCAGTGGGGCAGCACACCGGCTGGCAGATGTCATGGCCCAGACACACATAG AAAATCATTCTGCACCTCCTGATGTAAC

CACCTACACCTCAGAACACTCAATACAAGTGGAAAGGCCGCAGGGCTCCACCACATCCCGGACAGCACCAAAGTATGGCAATGCTGAGCTCATGGAGACT

GGGGATG GTGTACCAGTAAGTAGCCGGGTATCAGCAAAAATTCAGCAGCTTGTCAATACCCTTAAACGACCGAAGCGGCCACCATTACGGGAATTCTTT

GTTGATGACTTTGAAGAATTGTTAGAAG TTCAACAACCAGATCCAAACCAACCAAAGCCAGAGGGCGCCCAGATGCTGGCCACAAGAGGGGAGCAGTTG

GGAGTCGTCACAAACTGGCCACCCTCTTTAGAAGCTGCACTACAACGATGGGGGACCATCTCCCCGAAGGCCCCCTGCCTGACCACCATGGACACAAATG

GAAAGCCCCTGTACATCCTCACTTATG GCAAACTATGGACACGAAGTATGAAGGTTGCTTACAACATTCTACATAAACTAGGTACAAAGCAAGAACCTA

TGGTACGGCCTGGAGACAGG GTGGCGCTAGTGTTCCCCAACAATGACCCTGCTGCTTTCATGGTGGCCTTCTATGGTTGCTTGCTGGCTGAAGTTGTTC

CTGTCCCCATTGAAGTGCCACTCACAAGAAAG GATGCAGGGAGCCAACAGATAGGTTTCTTGCTTGGAAGCTGTGGAGTAACTGTTGCCTTGACTAGTG

ATGCCTGTCACAAAGGACTGCCAAAAAGCCCAACAGGAGAGATCCCACAGTTCAAAG GTTGGCCAAAGCTGCTATGGTTTGTCACAGAATCAAAACACC

TCTCTAAACCTCCTCGGGATTGGTTTCCACACATCAAAGATGCAAATAATGACACAGCTTATATTGAG TATAAGACGTGTAAAGATGGAAGTGTTCTTG

GTGTGACCGTGACGAGGATAGCGCTGCTGACACACTGTCAGGCACTCACACAGGCCTGCGGCTATACAGAAG CTGAAACCATTGTGAATGTTCTAGACT

TCAAGAAAGATGTGGGGCTCTGGCATGGCATATTGACA AGTGTCATGAACATGATGCACGTCATCAGCATCCCATACTCGCTGATGAAGGTAAACCCCC

TCTCCTGGATCCAGAAGGTCTGCCAGTATAAAG CAAAAGTGGCTTGTGTGAAATCAAGAGACATGCACTGGGCACTTGTAGCACACAGAGATCAGAGAG

ATGTCAACCTGTCCTCGCTGCGCATGTTAATAGTGGCTGATGGAGCAAATCCCT - UNI32383 - GGTCTATTTCTTCTTGTGATGCGTTTCTCAAT

GTCTTCCAGAGTAAAGGCCTTCGACAGGAGGTCATCTGTCCCTGTGCCAGCTCACCAGAGGCCCTCACTGTGGCAATCCGGAG GCGTGGGTATGGAAGG

T TAGGAAATCACAGTG GACGAGGTGTGCTATCCATGCATGGGCTGACCTATGGTGTGATACGTGTGGATTCAGAGGAGAAGCTGTCCGTGCTCACAGT

GCAGGATGTAGGCCTTGTTATGCCTGGAG CCATCATGTGTTCAGTGAAGCCAGATGGGATTCCTCAGTTGTGCAGGACGGATGAAATCGGGGAGCTCTG

TGTCTGTGCAGTTGCCACAGGAACATCATATTATGGTCTCTCTGGCATGACCAAGAACACCTTTGAG GTATTTCCCATGACAAGCTCCGGGGCTCCGAT

CAGTGAATACCCATTCATAAGGACAGGTTTGCTGGGATTTGTTGGTCCTGGGGGCCTCGTCTTTGTTGTGGGTAAGATGGACGGCCTGATGGTAGTCAGT

GGAAGAAGACACAATGCAGATGACATTGTGGCCACAGCCTTAGCTGTAGAGCCCATGAAGTTTGTCTACAGAGGCAG GATAGCTGTGTTCTCAGTGACT

GTCCTTCATGATGAAAGGATAGTGATTGTGGCTGAGCAGAGGCCGGACTCCACAGAGGAAGACAGTTTCCAGTGGATGAGCAGAGTACTCCAG GCAATT

GACAGTATACATCAAGTTGGAGTTTATTGCCTGGCCTTGGTACCAGCAAATACCCTTCCCAAAACCCCACTTGGTGGCATCCATTTGTCAGAAACAAAGC

AGCTTTTCCTGGAGGGCTCCCTTCACCCCTGCAATGTCCTGATGTGCCCACACACCTGTGTCACAAATTTACCGAAACCTCGGCAAAAGCAGCCAG AAA

TTGGCCCTGCCTCAGTGATGGTGGGAAATCTAGTATCTGGGAAGAGGATTGCCCAGGCTAGCGGCAGAGACCTGGGTCAGATAGAGGACAATGACCAGGC

CCGGAAG TTCCTGTTCCTCTCAGAGGTCTTACAGTGGAGAGCACAGACCACTCCTGACCATCTGCTGTACACTCTGCTCAACTGTCGG GGAACAATAG

CAAATTCCTTGACATGTGTTCAACTACACAAGCGTGCAGAAAAGATAGCAGTGATGCTGATGGAGAGGGGCCACCTGCAGGACGGAGACCATGTGGCATT

AGTCTACCCTCCAG GAATAGACCTTATCGCTGCATTTTATGGTTGCCTATATGCAGGCTGTGTGCCAATTACCGTGCGACCTCCACATCCACAGAACAT

TGCAACGACATTGCCTACAGTCAAGATGATCGTAGAG GTGAGTCGATCTGCTTGTCTCATGACAACACAACTGATATGTAAACTGCTTCGGTCCAGAGA

GGCAGCAGCAGCTGTAGATGTCAGGACATGGCCCCTCATACTGGACACAG ATGATTTGCCAAAGAAGCGGCCTGCCCAGATCTACAAACCTTCCAACCC

TGACACACTGGCTTACCTTGACTTTAGCGTGTCCACAACCGGGATGCTAGCTGGTGTAAAG ATGTCTCATGCAGCCACCAGTGCCTTTTGCCGTTCTAT

TAAGCTGCAGTGCGAGCTTTACCCTTCTAGAGAAGTGGCCATCTGCTTGGACCCTTACTGTGGACTTGGGTTTGTCCTCTGGTGTCTCTGCAG - UNI1

4337 - TGTATACTCAGGACACCAGTCCATTCTGATCCCACCCTCTGAGCTGGAGACCAATCCTGCCTTGTGGCTTCTTGCTGTGAGTCAATACAAAGT

CCGGGATACCTTCTGTTCCTATTCGGTGATGGAGCTTTGCACGAAAGGGCTGGGCTCACAAACTGAGTCCCTCAAG GCACGAGGCTTGGACTTGTCCCG

GGTAAGAACCTGTGTGGTTGTGGCAGAAGAGCGTCCCCGAATCGCCCTTACACAGTCTTTCTCAAAGCTCTTTAAGGACTTGGGTCTCCACCCACGAGCT

GTTAGTACTTCATTTGGCTGCAGAGTGAACCTGGCAATTTGCTTACAG GGGACATCAGGACCTGACCCCACCACTGTCTATGTTGACATGAGAGCCCTG

AGACATGACAG AGTCCGGTTGGTAGAAAGGGGATCTCCTCACAGCTTACCTCTGATGGAGTCTGGAAAA ATACTTCCTGGGGTCCGGATCATTATTGC

CAATCCAGAAACAAAAGGCCCACTGGGGGACTCCCACCTTGGAGAG ATCTGGGTTCACAGTGCCCACAATGCCAGTGGCTATTTTACCATTTATGGAGA

CGAATCTCTTCAGTCTGATCATTTCAACTCCCGGTTAAGTTTTGGAGACACCCAGACTATCTGGGCCCGAACTGGCTACCTGGGCTTTCTTCGGAGAACT

GAGCTCACAGATGCAAATGGAG AGCGCCATGATGCCCTCTATGTAGTGGGGGCACTGGATGAAGCCATGGAACTGCGAGGCATGAGGTACCACCCAATA

GACATAGAGACTTCAGTCATCAGAGCCCACAAAAGTGTCACAGAATG TGCTGTCTTTACCTGGACAAACCTGTTAGTGGTTGTGGTTGAACTTGATGGC

TCAGAGCAGGAAGCCTTGGACTTGGTTCCCTTGGTAACCAATGTGGTCCTGGAAGAGCATTACCTGATTGTAGGAGTAGTGGTCGTGGTGGACATCGGGG

TCATCCCCATCAACTCCCGGGGAGAGAAACAGCGGATGCACTTGCGAGACGGGTTCTTGGCAGACCAGCTGGACCCCATCTACGTGGCCTATAACATGTA

GTCTCATCGCTTTGACTTCCACAGACTTTTCTACGGACGGACGTGACCATTTTTCTTTCTTTTTTTTCCTTCTCAGTGTCCACAGAGACATGCAGACACT

CGGGCCACACTCAAAGGAGGAGCCTGATGCGGTGGGGTTTGGGGTAGTACTTCTAGGAGCAATCACCCTGGCATGGAGATGAAATGTGAATTTATGCTGG

ATTTTGCTCAGAAGGACTTTGGATCACTGCCTTCAGTTTGCTGGATAAGATCATTTTAAGAACTTTCTTTCCTTCCTTTTTTCTTTCTTTTTTCTTTTTT

TAATTATTGGATAAGAAGTGTTCTCTTCGTAAATGTGGTATTTTGTTAAGCCGAAATAGCAATTAAAAAAAAATAGTCTACCCTTCAAATGGGTTCTTTT

AAACAATTTATGTAGTGTGACAAGGAATTGTTTTTTCTGTTTTAATGTGTCATGGGATCTTACTGACATGGATCTGTTACTAATTTAAGCCATCCCTAGA

TCTCACCCTTCTAGGAGAGTTTATTGAGGTACGAGAACCTTCCAGGTAGCACCTTCCAATTAGATTTTAGCAGCTTGCTTTGTCAGAGACACGCTGAAGA

AACAGAGGCCAGTTCATGGCCTTTGAAGTTAACATAGAAGGAGAAGTGATTATAAATAAGGTATTTCGGCAACTATCTTGCAGATATCTTTGTACTAAAC

TAAAAAGATAAAAATAAGTTAACTTCCTCGATATGTAATTATGTACAAAATGTTTAATTTATTTTGATCTCTTTAGAAGTATAAAAGAGAAAAAACATTC

AAGAATATTAAAGTCTTGTAATGTTTGCTAATATAAAAAAAGTGTTGTATTATCTTGCGTGGATAGTATCACAACAAATATATATATATGAAATATAAAT

TCACTAATGAACAAAGGAGATTTTAAAGTTTAACTGCAGAACTTGTCACTTGCATGGTGCGCCCTCCACTGTATCCACACACACTTGGCTGTTTCCGAGC

AATCGCAGATCGCCAGGAACCCTGTCTTAGACCCAAGACCAGCAAGTGGAGTCACCGCTGTCTCTGAGAGGGTGAAGGGATTCAATGCTAACATGCACTA

TTTTTTCCTTTGCTGTGAGGACGACAGTGAATGCTTTCCTGCCAGCATGTGCCAGTGACATTGAGGGGCTCCAGGTTGGCAAACAGCACTGTTTTCTCAG

CTGCAAGAATTTGTTGCATAGTGTCAATTTTATTTTAGCATTTTTGTGTCACATTTTATAATTTTTGTTGTTGTTGTCCCTTGATATGAAGAGAATGACA

CCCTGTGGTCATTTGTACCACATTTGTGTCACTAATTTACCACTGCCAGTGGCCAATCTGAGCAGATAAATGACCAGAACGCCTTTGAGGGAAAAGCTAG

CTATATGTGATGTCTTCTCGACTGTGTAGACCCAGCCAACTCTGATCCTCCAATCTTGGGAACTCCCTAGCTTGGCCATGAGAGTAGGCACTAGTCCAGG

GACTTAAAACAGCAAGGAGTTCTGCCAGCATCATCCTTGTACTAGCCGTTGGGGAACTGATCCCTGGTCCCATGTGCCTATATTTTCATGTGCACAGGTT

AGCCACTGTATCCTTGTCTGTATCCAACCAAGGAGAAGATATCAACAATACAAGACAATGTTTATTTTGTAATTGCCACAGTATGGCTTCAGTGGCTCCT

AGTATGAGAGAAACCTAAAATTGTTATTCGGCAAAAATGAGGTTCCTGATTGCTTTATGGGCGAGGTCTTTGTCTGCCTTAGTTACAGCTGCCAACAGTA

AGCCCTTTGCTAAAAGAGCGTTTTCTATGACTTCCGAGATCCAAGGCTCATTTGTTTTGGTTTGTTATTAATTTAAGTGGTACATTTCTTTTGAAAATTT

ACATGTGTAAAGCATTATTCATCTCCATAAATCACTTAATTTTTCAAATATTGTTTGCTCATTGCTATATGTTTCTGCATGTTTCAAATACACATTCCTA

CAGTTTGCAGCTTCCCCAGGGGGGGAAATCCCTGCCACATACAGAAAGAATTTTCTTGATACATGCATTTGCACCCCCATACCTCCCCCCCCCCCAGGGA

ACTTGGTTTAATGTTTCAGATAGTAGACTGATTGGTAAACATGATTACAGTGTGCAGGAAATCTTCCATCTGGCTAATGTGAGGAAGCAAAGCAAATTTA

GATGTCACTCAGAACCTACTCTTAACTTTTCACCATATCAACTTCACACCCAAGGAGGGCGAAGGCTGCAGCACAGGGGCAAAGCCCATCCCAGCCGGTC

TCTTCTGTACCCTGCCATCTGTCACGTGACGCTTTAGGTTTCAAAGAGTTGGTGGACTCGGTTGGAAGCTTAGTTGTGCAAGAAAAAGGGAAGAAGACAC

TTAAGTACCACCAGTTTCAGCAATAAAGAAGGATCGTTGTGTATTAGAAACCGTACTGTAGATAAATCATTCATGAGAATGTTTTTTAAAAAGAAAAATG

TTTGTCTTGTGACCATGTGCTTTTGGAGTCAGCCAAAACCGTGTAATCAACTTGCACAAAAAGAGGGTACACAATGAACATTGAGACACAGACCTAATCA

AACAGGAGCAGATTCCTCATGGTGCTTGTTTATTATATATATTTAACCCTGCTTGACACTTTACCCAAGGGGACGGTCCCTTTATCAGTTGAATGTTAGC

AGCGTTATTTCAGAGTGTGGTGACTGGTTAGAGAAAACTCATGTACTCAACCAATCACAGTTTCAAACAAAATTTTTATGTGCAAAGGACAGCAACCTTC

TTGTATGTTCAACCACCAGTACGCTTTGTACATCTGTGATAACGCCTGTTTTATATTCAAATGAACAAATAAAAGCTTTTATTTTTGTTGCTCTGA
Translation
MADRSLEGMALPLEVRARLAELELELSEG - UNI31282 - GDITQKGYEKKRSKLIGAYLPQPPR - UNI5916 - - UNI23665 - RVDQAL

PQERRAPVTPSSASRYHRRRSSGSRDERYRSD - UNI5916 - - UNI27285 - DVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSMDAYTPP

D DTSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIE ENHSAPPDVTTYTSEHSIQVERPQGS

TTSRTAPKYGNAELMETGDG GVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEV VQQPDPNQPKPEGAQMLATRGEQLGVVTNWPPSLEAA

LQRWGTISPKAPCLTTMDTNGKPLYILTYG GKLWTRSMKVAYNILHKLGTKQEPMVRPGDR VALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRK

 DAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKG GWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIE YKTCKDGSVLGVTVTRIA

LLTHCQALTQACGYTEA AETIVNVLDFKKDVGLWHGILT SVMNMMHVISIPYSLMKVNPLSWIQKVCQYKA AKVACVKSRDMHWALVAHRDQRDVNL

SSLRMLIVADGANPW - UNI32383 - WSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRR RRGYGRL LGNHSG GRGVLSMHGLTYGVIR

VDSEEKLSVLTVQDVGLVMPGA AIMCSVKPDGIPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFE VFPMTSSGAPISEYPFIRTGLLGFVGPGGL

VFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGR RIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQ AIDSIHQVGVYCLALVPAN

TLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQKQPE EIGPASVMVGNLVSGKRIAQASGRDLGQIEDNDQARK FLFLSEVLQWRA

QTTPDHLLYTLLNCR GTIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPG GIDLIAAFYGCLYAGCVPITVRPPHPQNIATTLPTVKMIVE

 VSRSACLMTTQLICKLLRSREAAAAVDVRTWPLILDTD DDLPKKRPAQIYKPSNPDTLAYLDFSVSTTGMLAGVK MSHAATSAFCRSIKLQCELYPS

REVAICLDPYCGLGFVLWCLCS - UNI14337 - SVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLK ARGLDL

SRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQ GTSGPDPTTVYVDMRALRHDR RVRLVERGSPHSLPLMESGK ILPGV

RIIIANPETKGPLGDSHLGE IWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGE ERHDALYVVGALDEAMELR

GMRYHPIDIETSVIRAHKSVTEC CAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLD

PIYVAYNM

For any suggestions or comments, please send an email to unitrap@crg.es