Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048281 (Dleu7)
Chromosomal location
Chr 14: 62895068 - 62911800 (-)
Description
deleted in lymphocytic leukemia, 7 Gene [Source:MGI Symbol;Acc:MGI:2447771]
RefSeq_dna
NM_173419 
RefSeq_peptide
NP_775595.1 
UniGene
Mm.127330 Mm.409698 
MGI
MGI:2447771 
Uniprot/SWISSPROT
Q8CHZ8 
Human Ortholog
ENSG00000186047 (DLEU7)
Omim not available
UniTrap UNI21691
Vector Insertion
Chr 14: 62895946 - 62911364
Public Clones not available
Private Clones OST320970 (lexicon) OST232687 (lexicon) OST190597 (lexicon) OST186669 (lexicon)
OST180013 (lexicon) OST176001 (lexicon) OST134075 (lexicon) OST111904 (lexicon)
OST66346 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063169
Sequence
CTGCTAGCCGGCTATGGCCAGCCCTGCGCCCTTAGTGGCTTCCATCAGCCACCAAATGGTGGCTCTGCAGACCCTGCAGCTACTACAGCAGGAGTGGGGC

TGGGGCGACGGTCCTAGCGCCCCAGGGAGCCCGCGCGGCCCGGACCACGTGCCCATCGCCCAGGCTCGTCGCCCAGGCCAGCTGCGGACCCGGAGGGGGC

TGGGACGCGGGAGCATCGGAGCGCGGGGATCCCCCGAGGCAGGCGGGCTGCGGGGCGCAGAGGGGGGCGCCGAGCTGCTGCCTTTCCCCCGGGACCGCGG

GCCCTGTACCTTGGCGCGGATGGCGATGCGCAGCGCTCTGGCTCGGGTGGTGGACTCGACCTCGGAGCTGGTCAGCGTAGAGCAGACTCTGCTTGGGCCT

CTCCAGCAGGAGCGGCCCTTCCCTGTCCACCTGAAG - UNI21691 - GATAGCGTGGAATTTAGAAACATCTGCAGTCACTTGGCTCTGCAGATTGA

AGGACAGCAGTTTGACAGAGACTTGAATGCCGCTCACCAGTGTCTGAAAACCATAGTGAAGAAGTTGATCCAGTCACTTGCTAATCTCCCATCAGATGCC

CACGTGGTTGCCTGCGCTTCCTTGAGACAGATCTTACAGAATCTCCCAGATGTATGAGTACAAGAGGCAGCCAGACTACAGCTGGCCCTGCCAAGGAAAC

AGAATCCTTCACCTTCTAAACAGTCAGCAGCGATGGGTGTTTATGTGGCCAAAAGAACTTGATAGTTCATGTCTATGTCTGACCAAGAGCATCTGTAGCC

TACAGCATGATAGCATGTAGTATGTATATTTTTAAAGTAGTTGTGTATATTTTTCAAGCATATTGACTTACTGTTGACTTTCTGAAGTATACTTCTTTGG

GGAGCTAATTGGACTATATATATGTATATATTTATTAGCCATCTTAAGCCTGGGTTTTGAATGAATGATATTTAAATCTATATTTGTATTATCGTCAGCT

ATAAGGCTTAATAGGGACATGTATAGTAGAAAGATTACAGATCTTCATGTGATTTTGAGTAAATGGAACATTTACTCAATGGGACATAGTCTGTTTACTG

GGCACTTCATTGTAGACAGTGACAGTGATCTTTAGTTGTAGAACTATCGGTGTCAGTCATTGTGAGTCCAGCTCTGTCATTAGTAATTGACCACTGGGCA

GGAAGAGCTGCTTCTAAACTTTGTACTATCACATACTGCTCTGCCCATTTAAAATGATAATGAACTATGGGGTACCAAGCATAGTTAATATGTAAATACA

AGTACATACTATTAAAGTCTCAATGTGG
Translation
MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPSAPGSPRGPDHVPIAQARRPGQLRTRRGLGRGSIGARGSPEAGGLRGAEGGAELLPFPRDRGPCTL

ARMAMRSALARVVDSTSELVSVEQTLLGPLQQERPFPVHLK - UNI21691 - DSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLAN

LPSDAHVVACASLRQILQNLPDV

For any suggestions or comments, please send an email to unitrap@crg.es