Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048327 (Ckap2l)
Chromosomal location
Chr 2: 129094619 - 129122900 (-)
Description
cytoskeleton associated protein 2-like Gene [Source:MGI (curated);Acc:Ckap2l-001]
RefSeq_dna
NM_181589 
RefSeq_peptide
NP_853620.1 
MGI
MGI:1917716 
Uniprot/SWISSPROT
Q7TS74 
Human Ortholog
ENSG00000169607 (CKAP2L)
Omim not available
UniTrap UNI27286
Vector Insertion
Chr 2: 129122117 - 129122840
Public Clones (sanger)
Private Clones OST64977 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4691
Vector Insertion
Chr 2: 129111837 - 129116693
Public Clones AC0424 (sanger) IST10055H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052708
Sequence
GAAGAAACTGTCGCCGTAGAGCCATGGTGGGGCCCGGCCCCACTGCCAGCGCAGCCGCGG - UNI27286 - AAGAACGGTGGCAGAAGCTCCAGGAG

TACCTGGCAGCCAAGGGAAAGCTAAAGGACCCCAACGCCAA GCCTTATCTAAAAGCCAAGAATATCTGCCCCAAACCACCACCATCTAAATAT - UNI

4691 - ACTCCTGGACCTAAAAAAGATGTTTCCAATCATGTTTTGCCTAGCAAAACTACAAGACCCATCAACATTAAATTCCAGACTAAACCAGCCAGT

ATCACAGCATCCCAGAAGCCAGAGTCGAAGCCACCAAAACTTCCAAGCAGAGGACTCACGTCAAGATGTTTTTCTTCTAACACAGACTGTAAACAGTCCA

GCAAGCCTCAGCAGCAACCTAGAGCAGTGTCATTCACTGCAGGACTGTCAAGAAACCCCAGGCAGTGCCCTGATATACAGGAACTAAAAACCAAACAGCA

ACAGCAAGCACATGGAGGAAATGCTAAATGTACACATCCCGAGACTAACACCCACGCTGCAAAGCAACCTGTGGATGGCTTTCCAGATGAAACAAACAAA

GAAAACTTGCCCCAGGCCCTGCCAAAACCTGAGAAGCCAGATCCTGAGTTACATTCTATAAGAAAGCCAAATACTGGCTCTTCTAATCAAACTCAGAAAG

GTCTGGCTCCTAAACAGATCTTGAGCAAAAGTTCAGTTACTCAGACTGCTCTGAAAGACAGAGCTAACAAACAGTTCATTCGAAACACACAAATCAGAAC

TCAAGCAGTGAAGTCTCGGCCACGCCCTACAGTTGCAGATTCTACACGACCAAGAGAAAAACCCCCACAAACAGCTCCCTCTCATTCCGTTCCAGCCCAT

AATAAGACTCAGACATCAAAGAAACCAATGACCAAGAACACACAGGACATAACGGTTAACAGGGTTAGATACGGAAAACCAAATGAAACTAAGATAGAGT

CATGCCCTGCTACTGAACAGAAAGTAAAACACACTAAACCTAGTTCCCAACTCAATGTGCTTCAGGGAGGACATAACAGTAGACATCCCAACATGAGACA

GGATCAGAAGCCTGTACAGCCTCATCTTGGACCCCAGACGTCATGCGTTCTGCAAAAATCAAGAGCCATAAGCCAGAGGCCTAATTTGACAGCTAGAAAC

TTTAATTCAGTCATCCCAAGCACGCCTAACATGAGAGCAAATAAAACACTTAACAATAAGTACAATAACATCTTTCAACAAAAGGCACAGACATTGGACT

CCAAGTTCAGAAAGTTTCCTCCCCAGAGCCATTTTTTGAACAAGACTGCTCCCAGGACTCAAGCCAGTACAGCAGCCGCAAGTAGGAAGGGAGCCCCAAG

TGCGACCCAGACTCACCCACATGGTAAAAAACCAGAAGGAGAGGATCGGAG AAAACAGCTGGAAGAATGGCAGAAATCCAAAGGGAAAACCTATAAACG

ACCTCCCATGAAATTTAAAACAAAAAGAAAAGTCATAGAGGAAATGAACACTTCCTTCTGGAAGAGCATTGAAAGAGAAGAAGAAGAAAAGAAAGCTCAG

CTGGAGCTGTCCAAGAAAATCGACAGCACTCTGACAGAGTGTCTGAGGCTCATTGAAGAG GGTGTACTTCCTAATGAAATATTCACCATAGTATCCAGT

ATTCCTGAGGCTGAAAAATTTGCCAAGTTCTGGGTGTGCAAAGCAAAGTTACTGGCAAGCAAAGGCACCTTTGATGCTATTGGACTATACGAAGAGGCCA

TTCAGAACGGGGCAACA CCAGTACAGGAGCTGCAGGAAGTTCTGAACGTTCTACAAGACCCATGCAGGAGCACAGAAG CAGTAACCTCTGACACCTCA

GCTGCTGGAACTAATACCACATCTGCAGAGGAGCTGGCCAAGGAGGAATCTGAGCAGCCTTGCCCATCTCTAACAGAAATGGAGCCTATTGCAGCAGCAG

CACCGCGGATACCTGTTTCAGAGTGGGATAACCATGGTATCAAATTACAGGTTGCTCCGATCCCTAG AATATGCGGGATGCCAGAAGTGCAAGACATGA

AGCTTATCACTCCCGTGAGGCGCTCAGCCAGGATCGAGCGCACGGTGGCTCGCTACCCAGAAATGCTGCAGGAGCATGATGTGGTGGTGGCTTCTCTTAA

TGAGCTACTGGAAGTGGACAAAACAGAGTGTTTCATCTTCCGTGAAAATGAGGCTTTGCCTGTGACACTGGGCTTTGAAGTCCTTGAATCATGATCTTTT

GATATTTGTGGGTTTTGTTTTGTTTTTTTAACTTTAAGTGAGGTTTTTTTCAGAGCTTGCAAGACATAAATGCCCTTGTCAAGATGACATGAAATAAATG

TTTGCTGAGACCTCACCATGCAGGTGGTAGACTCTTTGGTCTCAGAAGG
Translation
MVGPGPTASAAAE - UNI27286 - EERWQKLQEYLAAKGKLKDPNAK KPYLKAKNICPKPPPSKY - UNI4691 - TPGPKKDVSNHVLPSKTT

RPINIKFQTKPASITASQKPESKPPKLPSRGLTSRCFSSNTDCKQSSKPQQQPRAVSFTAGLSRNPRQCPDIQELKTKQQQQAHGGNAKCTHPETNTHAA

KQPVDGFPDETNKENLPQALPKPEKPDPELHSIRKPNTGSSNQTQKGLAPKQILSKSSVTQTALKDRANKQFIRNTQIRTQAVKSRPRPTVADSTRPREK

PPQTAPSHSVPAHNKTQTSKKPMTKNTQDITVNRVRYGKPNETKIESCPATEQKVKHTKPSSQLNVLQGGHNSRHPNMRQDQKPVQPHLGPQTSCVLQKS

RAISQRPNLTARNFNSVIPSTPNMRANKTLNNKYNNIFQQKAQTLDSKFRKFPPQSHFLNKTAPRTQASTAAASRKGAPSATQTHPHGKKPEGEDRR RK

QLEEWQKSKGKTYKRPPMKFKTKRKVIEEMNTSFWKSIEREEEEKKAQLELSKKIDSTLTECLRLIEE GVLPNEIFTIVSSIPEAEKFAKFWVCKAKLL

ASKGTFDAIGLYEEAIQNGAT PVQELQEVLNVLQDPCRSTEA AVTSDTSAAGTNTTSAEELAKEESEQPCPSLTEMEPIAAAAPRIPVSEWDNHGIKL

QVAPIPR RICGMPEVQDMKLITPVRRSARIERTVARYPEMLQEHDVVVASLNELLEVDKTECFIFRENEALPVTLGFEVLES

For any suggestions or comments, please send an email to unitrap@crg.es