Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048330 (Ric3)
Chromosomal location
Chr 7: 116177839 - 116226838 (-)
Description
resistance to inhibitors of cholinesterase 3 homolog (C. elegans) Gene [Source:MGI (curated);Acc:Ric3-001]
RefSeq_dna
NM_001038624 
RefSeq_peptide
NP_001033713.1 NP_848895.2 
UniGene
Mm.71007 
MGI
MGI:2443887 
Uniprot/SWISSPROT
Q8BPM6 
Human Ortholog
ENSG00000166405 (RIC3)
Omim not available
UniTrap UNI28102
Vector Insertion
Chr 7: 116201524 - 116226676
Public Clones not available
Private Clones OST40017 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055993
Sequence
GTTCCGGTTCGGACTCCTGGGTCCTGCGGTACGCAGCCATGGCGTACTCCACGGTGCAGAGAGTGGCGCTGGCCTCGGGGCTCGTCCTGGCCGTGTCGCT

GCTGCTGCCCAAGGCCTTCTTGTCTCGCGGGAAGCGACCGGAGCCGCCGCCGGGCCCGGAAG - UNI28102 - GAAAATTGGACCGATTTCCACCTA

TGATGCATCACCACTCGGCACCCTCAGATGGTCAGACACCAGGGGCTCGTTTCCAGAGGTCTCACCTTGCAGAGGCCTTTGCAAAGGCCAAGGGAGCAGG

TGGAGGTGCTGGAGGAGGGGGTAGTGGAAGAGGACTGATGGGCCAGATCATTCCAATCTATGGCTTTGGGATCTTTTTGTACATACTGTACATTTTGTTT

AAG CTTTCAAAGGGGAAAACTGCAGAGGATCGGAACTGCTCCACTGCCCCACCTGGAAACGCCCACAGGAAGATTA CCAACTTTGAGCTTGTTCAACT

ACAAGAAAAACTAAAAGAGACAGAAGAAGCCATGGAAAAATTAATCAACAGAGTTGGACCTAATGGTGAGAG CAGAGCACAGGCTGTGACTTCTGACCA

AGAGAAACGATTACTGCATCAGCTCCGAGAAATCACCAGGGTCATGAAAGAAGGCAAGTTCATCGACACATCTCCAGAGAAGGAAGCTGAGGAAGCCCCA

TACATGGAGGACTGGGAAG GTTACCCAGAAGAGACTTATCCAATATATGACCTTTCGGATGGTATCAAGCGTAGGCAAGAAACAATCCTGGTGGATTAC

CCTGACCTAAAAGAGCCCTCTGCTGAAGAAATTGCTGAACAAATGGGAGAGATAGAAGAGGAAGGATCAGAGCGTTTGAGCTGGGATCATTTGCCCACTG

ACCCTGGAGCCCAGAAAGATAATTCTGTTGCCCCGTGTGATCCCAAACCAGAATCATGCTCCTGCTGTGTTCATGAAGAGGAGGATCCTGCTGTCTTGGC

AGAGAATGCTGGTTTCAGTGCAGATGGCTACAGTGAGCAAGAGGAAGCCACCAAGGAAAACTTGCCCCAGGACTTTACAAATGAAGGGCTGGGAGTCAGC

ACTGATAATGCACACGTGGGTGGTATGTTGAGGAAGCGCAACCCCCAGGGTTTTGAGTGAAAGCAGCCTGCTTGGGAAAGTATCCATTACTCTGTTCCCA

TGGCACCTTTCCTCAGTTTCATCCATGGCCTTGTGCCCTCTGCATCCTCTGTGTTCAATACCATAGCTCTTGGGCCACTACCATGGATACAGCTAATCCT

TCCCGGTGCTTGCACACCTGTCACTTTGTAAAGTAGCCAGTAGTGTGAACACGGGACAGAATCACCTTCCTAGTCATGCGCTTCCCTATCAGAGTGTGAA

CACAGCACAGAATCACCTTCCTATTCATGAGTTTCCCTATCAGAGACACTAATCCACTCGGTAATTGTATTTGGTTGTTTGTGCTTGCAGGTGGTACCAC

CTAGGCAAATGTCTGACCCCTCCTCATAGGAGCAACAGATGATTTACCTGTGAATGATTTATTGAATGGATTTGTTAGGATAGGATGACCGTGAAAGAGA

ACTGGGTTAGCTGATATTGAGGACTTAAGTTTTAAGAATGAAGATTTTAGATTCCCAAATGCCTTATTCTTTGGGCCTTCAGCTGGTTAGTGGTCCCTGA

GAAGAGCATGCTCAATTCTGAGCCTAGGGGCCCAGAGCACAGCAAGATATCTGATTGAGCTGCAGTCTCTCCTCACAGCCTTCTAAGATGCCCTGACTCC

TCCAGAGCAGCAGGCCATGAACTCACGGGCCTATTTGGAGACCATTTTGCTTGTATATTCCCTCGATCCCTGCTTCCTTTGTCTTTATTCTGTTGAACAG

AACTGCCAAATCTAGAGGCAACTCTGAATGTCTTCTGTGGCTAGAGGGATTTGGAGGCATTAATCTGTGTCCCACAGAGCTGAAGTTTGAGGCTGTTGAA

GCTACAGGACTGCTTAAGTATGGTGGTCCTTCCATGAGGAGCTCAAGTAGCCAGGAAACCCTGAGAATTCTAACAAGGGTGTGTCAGTTCAGTTACATGA

ATTGAAAGCTGAAAGGCTGTGCATCTCCAACAACATTCCGAGTCATGAAATGGGAGACTCAAAATTTAAGGAATTCTGTGAAGCTGGATAGTCTTTAGAG

TTCTATTGTGCCTGGCATGCCTATGATGCCAGAAGATAGTTTGGACCACTCAGGAGCGTACTGCCCTGGCTGTCATCAGGTCTGAGACCACACTAAGACA

CTGTCAGCTACTAGAAAGCTTTACATGTTAACGGGACTAGAGAAACACAAACGCTGCACTGTACCAATCCCTGTGTAGAATGTTTGATTGAAATTGTGCA

GAATGCAGTTGAACATGTACTGAAGATGGTCTTGACATAACTAAGTGTAAAAAGCAACGCAGATACTCTTGTTTGAGCAGATTGTTTTCTGGATGGTTCT

GGCATCCACCATGAGAAGTTGATTTAAGATAGCCCCGTATCACTGGTTCTAATTTTTGTTCATAGGATATAATTCTGTTATTAGATAAGAACTTGTTTCC

TTCTCATTCATTTGTTGGACAACGGCCCTGTGCTAAGTACTGAGTGTCTGTGCATAGTCCAATGCCCCAACTAAGAAGACTGAATTTGTACGAATTTCAG

TTTAATGTGCTAATCTAACAGATGCACTATGGACCATAGGAAGGCTAGAGATTGTGAATTCTTCAGACAGATTTCCCTGCAATTCAGGCTGTGGAATTCT

GGATTGGCTCCTTAAGCATCCCAAGCCTGGTTGGGCATCTATAAAGTGTGAGGGTAGTAAAAACACAGGTCTTACAGGGCTGTAAGCTGCAAATGAGGTA

GTCAGTGCACATAGGGCAGCATGCTTATGTTGTTAGCTCATGCAAAACAACATATCATGTGGTAGCTGTTTTATTCATTATAGTGTGGACCCTAAACTGT

AGGAGCACAGAAGAACAAGAATGTTCTTGCCAAGTACCAAAAAAATCTCAGAGACACCTTGTGGAAAGCTAAAACATGGCAAGAGGAGGAAGGACATTTG

GGCAAAAAAAGTAGGTTAGCAAGAACAGTGTGGTTGGTGTATAGATGGGTAATCAGGTGAAAAGGGTTTAGCACCAACTCTATCATTGGGGATTAGCTAT

GGAAACAATTCCTGCCAAAAGGACCAGTCCTTCATGGTTCTTGCCACTCTACATGTTAGTCTGCATATAGGAATATATTTGTTTGTATATACCAGAAACT

TTGAAGAACCTATTAGTAATTTGGAATATAGGCATTTTTTCCCAGAATTTTATCTTTTAGATATGATTTTTACAGGTTGACCAAAATCAAGGGGCTTGGT

TTCATTGTATGATCTTCATTTCTCAATATTAAGGGTTTCATCAAGGCCTTACCATTAGGTCTCCAGTGACCTATGGGGCACCATAGCAGTAGTTGGCCTA

AGAAGCCACTGTACATCACCTAGGAGTGTGCTTGGTAAGTCAGGTGGGTGATCAGCCAGAAGACCCCTTAACACAGCTATGGAACAAGACTGTGTGCCTC

CTTATCTCAAGGCCTGGGCCTGGGAGGTATGCTGAAGAGTGGAGATGGACTCAGCCTCTAGAAATAATGGCTTGAGAGAATTATGTTCTTTGTATTTAGA

CTTAAGCAATAATGGTCTTCACTCAGACACTCTGGAAAGAAGAACCTAAACTCACGGCATAATTAAACGTTCTCATTGTATGGAAGGTAACAATGCAGGA

GGAGCATGTAGTTGAGGGCAGTCCTTCAGGGCAGCAGGAGCCAGCGGGCAGGCTCACAGGGAGCTGAGGTGAATGATGATACACAGCACTTGGCTTGTTT

TGCCCCTCTTATCAGTCTGGGACCCCAGCCAAAGGGATGATACTGTCCATAGTAAGGATGGGTCTTCCTCCTCAACTAACTTTCTTGTAAACACCTTCAT

AGACAAGTATGTTTTCATGGTGATTCTAAGCCCCTTAAGTTGGCAATCAAGAGCAAACCAGAGGTAATAGGTATAAATAAAGATTTTCCTCTGCATGTGT

TCTACACAATTGAGGATTTTTTCTTAAACTTGATGACTAAACAAACAAAACCTCTTCCCTTTGTCGAACACCCTGTATATGGTCTTCACAAATGCAATCA

CTACAGGAACCAGGCCATGTTCAGGTAGGGAATGCTTTTGACTCACATCAAAAACACTTAGCTGAGTAGATAAATGAACCCTAATTATAGACCTGCTCTT

AAATTCTTTTTATTTAGACAATTTGTATCTGCAAAGAACATTTCATATGTCACCTATTGGGCAGTGATCAGGAAGGATACTAATCAACTATTCTGTAATC

TCCTTAACCATTAGCATGTCTAAAACACTTTGTAGTATCAAAAAACCAGGCCATTCCTTCACTTCAAAGGGTACCACTTTCCTTATGGATGGACCAGGAA

TCACGTCCACCTTACAGGACTGTTTCTGAAAGCTGCCCAGTGTGAAGTGTGCAATGGTAGGTGCTTATTAGCACATCACTGTCTTGAATCTCATGCTTCT

GGACTACCCAACTTGATACTCTATGGCCACTCTGCATGCCAAGAATGGTCCAGAGTCACTCTGAGGAGTTCTTGTGACTTTGTGATGACTCCTTTTAGAA

CAACTATAGGCTTTCATCATGTTGGCCTCAAATCCACCACAGACTGAAAAAGGGTTCCCACTATGTAAGAGTCCTGTTTAAATAGACCCACCTCCAAGCA

AGGCCTGCAGTCATGTGGCTGGGCCTTTCCCACTCTTGAGTACTACAGCCCAGTTCTGTCCACAAGGGCCATGTCCACCAAGCATACTTAAGAACTGTCA

GCCAGTTCCTTAAGTGACCAGATGACCTGAAGTATCCTCTAACCCTTTTTTCCCCATGCTATAGATGTGGTTTCACAGGAGAAGGCAGTGCTGATCTGTA

TGCCACTCACTGGTTCTAAACGTGCTCTGGGCCCTCAGTTGCTCTTACGCACCTGACCCTTTGAAGCGCCTAGAAAGGACTGGGATGGAGAACATTTTAG

GAGAGACATGTTCTCTTCTCTATGAAAACCAAGGACACAGCCGTCAAACAGTTCAAGTTTAATGTGTTGATACATGTCTGTACTTAGACAAACACTAAAT

TCTACAACATACATAATGTCATTATGGGAAAATACCAAGTTTGTCATTGCACATACCAATAAATAAATACATTTGCTTC
Translation
MAYSTVQRVALASGLVLAVSLLLPKAFLSRGKRPEPPPGPEG - UNI28102 - GKLDRFPPMMHHHSAPSDGQTPGARFQRSHLAEAFAKAKGAGGG

AGGGGSGRGLMGQIIPIYGFGIFLYILYILFK LSKGKTAEDRNCSTAPPGNAHRKIT TNFELVQLQEKLKETEEAMEKLINRVGPNGES SRAQAVTS

DQEKRLLHQLREITRVMKEGKFIDTSPEKEAEEAPYMEDWEG GYPEETYPIYDLSDGIKRRQETILVDYPDLKEPSAEEIAEQMGEIEEEGSERLSWDH

LPTDPGAQKDNSVAPCDPKPESCSCCVHEEEDPAVLAENAGFSADGYSEQEEATKENLPQDFTNEGLGVSTDNAHVGGMLRKRNPQGFE
Transcript ENSMUST00000120876
Sequence
TCCGGTTCGGACTCCTGGGTCCTGCGGTACGCAGCCATGGCGTACTCCACGGTGCAGAGAGTGGCGCTGGCCTCGGGGCTCGTCCTGGCCGTGTCGCTGC

TGCTGCCCAAGGCCTTCTTGTCTCGCGGGAAGCGACCGGAGCCGCCGCCGGGCCCGGAAG - UNI28102 - GAAAATTGGACCGATTTCCACCTATG

ATGCATCACCACTCGGCACCCTCAGATGGTCAGACACCAGGGGCTCGTTTCCAGAGGTCTCACCTTGCAGAGGCCTTTGCAAAGGCCAAGGGAGCAGGTG

GAGGTGCTGGAGGAGGGGGTAGTGGAAGAGGACTGATGGGCCAGATCATTCCAATCTATGGCTTTGGGATCTTTTTGTACATACTGTACATTTTGTTTAA

G CTTTCAAAGGGGAAAACTGCAGAGGATCGGAACTGCTCCACTGCCCCACCTGGAAACGCCCACAGGAAGATTA CCAACTTTGAGCTTGTTCAACTAC

AAGAAAAACTAAAAGAGACAGAAGAAGCCATGGAAAAATTAATCAACAGAGTTGGACCTAATGGTGAGAG AGCACAGGCTGTGACTTCTGACCAAGAGA

AACGATTACTGCATCAGCTCCGAGAAATCACCAGGGTCATGAAAGAAGGCAAGTTCATCGACACATCTCCAGAGAAGGAAGCTGAGGAAGCCCCATACAT

GGAGGACTGGGAAG GTTACCCAGAAGAGACTTATCCAATATATGACCTTTCGGATGGTATCAAGCGTAGGCAAGAAACAATCCTGGTGGATTACCCTGA

CCTAAAAGAGCCCTCTGCTGAAGAAATTGCTGAACAAATGGGAGAGATAGAAGAGGAAGGATCAGAGCGTTTGAGCTGGGATCATTTGCCCACTGACCCT

GGAGCCCAGAAAGATAATTCTGTTGCCCCGTGTGATCCCAAACCAGAATCATGCTCCTGCTGTGTTCATGAAGAGGAGGATCCTGCTGTCTTGGCAGAGA

ATGCTGGTTTCAGTGCAGATGGCTACAGTGAGCAAGAGGAAGCCACCAAGGAAAACTTGCCCCAGGACTTTACAAATGAAGGGCTGGGAGTCAGCACTGA

TAATGCACACGTGGGTGGTATGTTGAGGAAGCGCAACCCCCAGGGTTTTGAGTGAAAGCAGCCTGCTTGGGAAAGTATCCATTACTCTGTTCCCATGGCA

CCTTTCCTCAGTTTCATCCATGGCCTTGTGCCCTCTGCATCCTCTGTGTTCAATACCATAGCTCTTGGGCCACTACCATGGATACAGCTAATCCTTCCCG

GTGCTTGCACACCTGTCACTTTGTAAAGTAGCCAGTAGTGTGAACACGGGACAGAATCACCTTCCTAGTCATGCGCTTCCCTATCAGAGTGTGAACACAG

CACAGAATCACCTTCCTATTCATGAGTTTCCCTATCAGAGACACTAATCCACTCGGTAATTGTATTTGGTTGTTTGTGCTTGCAGGTGGTACCACCTAGG

CAAATGTCTGACCCCTCCTCATAGGAGCAACAGATGATTTACCTGTGAATGATTTATTGAATGGATTTGTTAGGATAGGATGACCGTGAAAGAGAACTGG

GTTAGCTGATATTGAGGACTTAAGTTTTAAGAATGAAGATTTTAGATTCCC
Translation
MAYSTVQRVALASGLVLAVSLLLPKAFLSRGKRPEPPPGPEG - UNI28102 - GKLDRFPPMMHHHSAPSDGQTPGARFQRSHLAEAFAKAKGAGGG

AGGGGSGRGLMGQIIPIYGFGIFLYILYILFK LSKGKTAEDRNCSTAPPGNAHRKIT TNFELVQLQEKLKETEEAMEKLINRVGPNGER RAQAVTSD

QEKRLLHQLREITRVMKEGKFIDTSPEKEAEEAPYMEDWEG GYPEETYPIYDLSDGIKRRQETILVDYPDLKEPSAEEIAEQMGEIEEEGSERLSWDHL

PTDPGAQKDNSVAPCDPKPESCSCCVHEEEDPAVLAENAGFSADGYSEQEEATKENLPQDFTNEGLGVSTDNAHVGGMLRKRNPQGFE

For any suggestions or comments, please send an email to unitrap@crg.es