Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048332 (Lhfp)
Chromosomal location
Chr 3: 52845469 - 53065597 (+)
Description
lipoma HMGIC fusion partner Gene [Source:MGI Symbol;Acc:MGI:1920048]
RefSeq_dna
NM_175386 
RefSeq_peptide
NP_780595.1 
UniGene
Mm.391616 
MGI
MGI:1920048 
Uniprot/SWISSPROT
Q8BM86 
Human Ortholog
ENSG00000183722 (LHFP)
Omim not available
UniTrap UNI30509
Vector Insertion
Chr 3: 52847614 - 53035651
Public Clones (sanger) IST10832C7 (tigm) IST14225F2 (tigm) IST12101E8 (tigm) IST11467C1 (tigm)
IST11467C4 (tigm) IST13504F4 (tigm) IST14661C5 (tigm) IST12680A9 (tigm)
IST10008F8 (tigm) IST14604B11 (tigm) IST10282G9 (tigm) IST10960D4 (tigm)
IST14180B2 (tigm) IST12577A9 (tigm) IST13496D9 (tigm) IST12947A11 (tigm)
IST13928F5 (tigm) IST12494E6 (tigm) IST14993G5 (tigm) IST14508C5 (tigm)
IST11044H4 (tigm) IST14410F9 (tigm) IST14768H9 (tigm) IST12618D8 (tigm)
IST12313G10 (tigm) IST14294G4 (tigm) IST11308D5 (tigm) IST11142D6 (tigm)
IST14919F2 (tigm) IST10390E5 (tigm) IST11190D9BBF1 (tigm) IST10872H1 (tigm)
IST11698A1 (tigm) IST10746E3 (tigm) IST13382F11 (tigm) IST10830D7 (tigm)
IST14742F6 (tigm) IST14769E9 (tigm) IST13682G7 (tigm) IST10997E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059562
Sequence
CCGGCATCCACCGTGTTCCCGGGCCGCACGGCCGCAGCCGGCGGGCTCTCCGGGTGGGTCCCCCTGACCCTCCACCCCAGCTCTCCAGACTCGCCTCGAT

CTCCGTCGGGATAGTGGCAAAGGCAAGAAAGACAGTCTTCTTTGGTGCCGCGCTGTCCCCGCCAGGGAAAGACAGCAAGTTGTGCTGCGCCCGGGACTCG

CGAGGGACCGCGGCCGCCGCCCGACCGG GGGCCACCAGCCATCTTCACTCCAAAGTATGAGAAGCTGATCGCGGTAATACTGAAACTCTGTTACGGCAA

GTAGCTACATACGCCTTGAAGAGCGGTGGACTACCTGGGAGTTTCTTGTGACTACACGCCTTCCTTCACACCTTTAGTGCAATCACAGCGGACCCTCATT

GCACTGCCTGTTGGAAGATGGCGTCCAGCCTGACTTGTACTGGGGTGATCTGGGCTTTGCTTTCCTTCCTTTCCGCTGCCACCTCCTGTGTGGGGTTCTT

CATGCCATACTGGCTCTGGGGGTCTCAGCTAGGCAAGCCTGTATCCTTTGGCACTTTCCGGAGGTGCTCCTATCCTGTTCACGATGAGAGTCGGCAGATG

ATGGTGATGGTGGAGGAGTGTGGGCGCTATGCCTCCTTCCAGGGCATCCCCAGCACCGAGTGGAGGATCTGTACCATAGTGACAGGCCTTGGCTGCGGCC

TGTTGCTCCTGGTGGCTCTCACTGCCCTGATGGGTTGCTGCGTGTCGGAACTCATCTCCAGGACTGTAGGAAGAGTGGCTGGGGGAATCCAGTTCCTGGG

GG - UNI30509 - GCTTGCTGATTGGTGCTGGCTGTGCCCTCTACCCCTTGGGCTGGGACAGTGAGGAAGTCCGGCAGACTTGTGGCTACATCTCTG

GCCAGTTTGACTTGG GCAAGTGTGAGATCGGCTGGGCCTACTACTGCACCGGGGCAGGGGCTGCGGCTGCCATGCTGCTGTGTACATGGATGGCTTGCT

TCTCAGGCAAGAAGCAAAAGCACTACCCCTACTGAGGTGGTCAAGAACGAGCTGAGGAGAGGACAGACCACCGGAGACCAGAGGGCCCGAAGCATCCAGC

GACTTTCACAAGGTGGAATAGTGGTTGTAAACCCAGAACAGTGTTAATGTGATGAAATTCGGTTGAATCTGGAACATTCTATAGGAAGGGAGGGTGGTGG

GGACATTGTCATTGTCAAAAGCATGGAGAATAAGGGACGGTGGAGGAAAATGGACCAAAGGCTAAAAACATTGCAGGGCATTGTTGTTTCTATTCCACAG

AGTACCGTTAATGTATATCATATACCCAGCAAATCTATATATGCAAACGAGGATCTCATTTTTGTTCTCCTTCAAAAAGATGAGGACTAGGGGAGTCAAA

AGGGCTAGTAGAAACAGTATTATCTTAGGAAGCAGGATGAGTACCCTGCAGACATTCCCTGTAGATGAGGATTGAGCCTGAAAGCACATGAGTACGTGCA

CACATATGCACACATCATATTCACATACCACATGCACATGTTATATGCACAGGTCATACGCACATGCCATATGCATACATCACACGCACACATCATACGC

ATATGTCATCACACCACTGCACAGGGGGTCAGCTGTGTACTGTTGCTCCTGTTTCTTTTCTTTTTTTTAATATACATCAGGACAGCATCATCACTAAGCA

TACATTAAGCCTAGTCCATGGACCAATATGCCACTCTATCAGTATTTTTGATATCCTGCATAAACTCTTTATGCCCGCAGCATATCTTTTAGTGTTTATG

CAAATCTTTAGAGGAAAGCCTTCAAATGTCAATGTTATTCAAAGACACACAGTAGTGAACTGAGTAGCTTCTGCTGTAACAACCTCACGTAGAACAGGAC

AGCTTTTGTCTACTATAGGTGAGAATTCAGTTGCAGATTTGAGAGTGAGGAGAGCTTTCTCCAGTTGTTGGATCTTCTTTTCTTTTCTCCATTATTCTAC

TGTGCTATACCATGATTATTTCAATATTCATTTTGTAAAGGGAAAAAAAAGTACTATTTTGTTTGTATTTGAAAAGCTCTGTGAATAAATTCTCTTTGAT

C
Translation
 MASSLTCTGVIWALLSFLSAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWRICTIVTGLGCGLLLLV

ALTALMGCCVSELISRTVGRVAGGIQFLGG - UNI30509 - GLLIGAGCALYPLGWDSEEVRQTCGYISGQFDLG GKCEIGWAYYCTGAGAAAAML

LCTWMACFSGKKQKHYPY

For any suggestions or comments, please send an email to unitrap@crg.es