Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048376 (F2r)
Chromosomal location
Chr 13: 96371759 - 96388414 (-)
Description
coagulation factor II (thrombin) receptor Gene [Source:MGI Symbol;Acc:MGI:101802]
RefSeq_dna
NM_010169 
RefSeq_peptide
NP_034299.2 
UniGene
Mm.24816 
MGI
MGI:101802 
Uniprot/SWISSPROT
P30558 
Uniprot/SPTREMBL
Q3UK34 
Human Ortholog
ENSG00000181104 (F2R)
Omim not available
UniTrap UNI26275
Vector Insertion
Chr 13: 96374893 - 96388241
Public Clones (sanger)
Private Clones OST127345 (lexicon) OST60521 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059193
Sequence
TCTAGTCACCCGCAGGCTCCGACCGAGCTACTCAGAAAGAAGTAGGCGACGGCGGGCGCCGGGCCGCGCGGGCAGCCTTGGGACAATGGGGCCCCGGCGC

TTGCTGATCGTCGCCCTCGGCCTCAGCCTGTGCGGTCCCTTGCTGTCTTCCCGCGTCCCTATGAGCCAGCCAG - UNI26275 - AATCAGAGAGGAC

AGATGCTACGGTGAACCCCCGCTCATTCTTTCTAAGGAATCCCAGTGAAAATACATTTGAACTGGTCCCCCTGGGGGATGAGGAGGAGGAGGAGAAAAAT

GAAAGCGTCCTGCTGGAGGGTAGGGCAGTCTACTTAAATATAAGCCTCCCTCCTCACACGCCGCCTCCTCCCTTCATCTCCGAGGACGCCTCCGGATATC

TGACCAGCCCCTGGCTGACGCTCTTCATGCCCTCCGTGTACACGATTGTGTTCATTGTCAGCCTTCCTCTGAACGTCCTGGCCATCGCAGTGTTCGTCTT

GAGGATGAAGGTCAAGAAGCCGGCCGTGGTGTACATGCTGCACCTGGCCATGGCCGACGTGCTCTTCGTGTCGGTGCTCCCCTTCAAGATCAGCTACTAC

TTCTCCGGCACTGATTGGCAGTTCGGGTCTGGAATGTGCCGCTTCGCCACCGCAGCGTTTTACGGGAACATGTACGCCTCCATCATGCTCATGACGGTCA

TAAGCATTGACCGGTTCCTGGCGGTGGTGTATCCGATCCAGTCCCTGTCCTGGCGCACTCTGGGCCGAGCCAACTTCACTTGCGTGGTCATTTGGGTGAT

GGCCATCATGGGGGTGGTGCCCCTTCTCCTCAAGGAGCAGACCACCCGAGTTCCGGGACTCAACATCACCACCTGCCACGACGTCCTCAGTGAGAACCTG

ATGCAAGGCTTTTACTCGTACTACTTCTCGGCCTTCTCCGCCATCTTCTTTCTTGTGCCGTTGATCGTTTCCACGGTCTGCTACACGTCCATCATCCGGT

GCCTGAGCTCCTCCGCGGTTGCCAACCGGAGCAAGAAGTCGCGGGCTTTGTTCCTGTCTGCCGCGGTGTTCTGCATCTTCATCGTCTGCTTTGGGCCCAC

CAACGTCCTCCTGATTGTGCACTACCTTTTCCTCTCCGACAGTCCTGGTACAGAGGCAGCCTACTTTGCTTACCTCCTCTGCGTCTGTGTGAGCAGCGTG

AGCTGCTGCATCGATCCGTTGATTTACTACTACGCCTCCTCCGAGTGCCAGAGGCACCTCTACAGCATCTTGTGCTGCAAAGAAAGCTCTGATCCCAACA

GTTGCAACAGCACCGGCCAGCTGATGCCGAGTAAAATGGATACCTGCTCTAGTCACCTGAATAACAGCATATACAAAAAGCTATTAGCTTAGGGAAAGGG

TTGCTGGAAGGTTCCATGAGAAAAGGTTGGAAAGCCAACAGCGGGGAATCCCATTAGTCCCTGCAAAGAACTGTATTTACTTCGAAACCTAAAAAACAAC

CAATATCCGATATGCACGAATACTTCTGCTATCAAGAGTCTAGATTGGATAATTACCAGCAAGGTGACGGGAACGGAAATAAAGGTGTCCAGTGTTGCTA

GTGCTATGATAGTAACTGGATGTCACTTCTTATATATCTAGGTGACTTTAATATATAGATGGTATGCACACACTCATTTGTCATGCAGGAGGGAATCTGC

ACTTTGACACATTTTTGTTTATTCCCTGGCCGTTACTATGGAAATAATCTGATTCTCTGACTTAATAAACAAAGTCTGAGTTGGTGGGTGTTAGCACTGG

GCAGCTGGAGATCCTAATGATAGGGGAGGAGTCCGTAGTTTAGACTTAACACAGCTTTTGCCTATATTTTTTTTCAAATTATTTGATAATAATGGTTAGT

GATGGAAGGATGAGACAGTATTACCTGTGTAGGGGAAGCTCTAATACTTTTCATCTTGAACATACCGTAGTTTTAAGAATTATCAAGGCTGTTGGAAAAC

CCGTTTTGATATGGGTAGCATTTTTTTTTTAACTTGCAATTTACTTACTGAATACATGGACCAAGACTGAGCATAAGACTCACCAGGACTGTAATAAACC

TTACAAAGCAGCCAAGCCTAGACACAGCCATCTGCATGGAGGCCTCTGAGCACCAGGTACATCACACCCCTTCGGCTATGCCTCCCAGAGAGCAGAGATG

GATGGGAAGCACCAGGCCCACCCCATCCTGCTAGGATTCTCATTAGCTGTGAGCTGACTGTGTCTTTTAGAAATTGGCAAGGTAAGGTATGCCATCTTGG

GAGGCAGTAACTATGAAAGACTGACGAGAGGAGAAAGGTGTGTTTACATCCAGTAGCTGTCCTGCAAGGCTGGCCCTTGCACAGACAGACACACCCACAT

GCCCTGGTCACACTGTTGGATAGTGGGCCATAGACTGACTATAGGAGAATAACCGAGTCCTGTCCTTACTCAGGCAACGCAGAGAGCTGGCATGTGGTCA

GCTATGATGCACATAGAACTTGTCTTCAGCTGGATGTGACCAAGTGTATTTCACATAAGCAAGGCCTATCAGCTAAACTGCTTTGCATATCTGAGTTTCT

GCTTCCAGTAGCTATAGATTAGGATAAAAACACAGTATAAGATGTATATTTTTAATACATATGCCCTTCAGCCTACAAAATTACACACTATTTATTTACA

AATGTTTTTTCAAAAATTACTCAAATCAGCCAGGCATTATGGTATACACCTTTAATCCCAGAACTTGGGAGGCAGAGGCAGGCAGATCTTAAACAATTTT

TTTTTTAAGAAACAAGCAAACACAAAAAGTTTTACTTAAGTCCAATTTTAAGAAATATATAGGTCAGTTTGGTTAAAAATAATAGTAATGAAAGGAAATT

TCATTGATTGAAATTTATTCTGTATTTTTCTTGAGTTATTGAGATTATTTGTAAAGCATTTTTAATGCCACAGTGACTAACAAGCATATAAAATCTTCAT

ACCTTTGACAAAATAATTTGAAAATTAATTTAAAACATATCCTTTTTCTGATGAAAAAATATGTTGGCATTTTAAGCAAATAAGAGTAGAAAGGTTGTTT

ATTTAAGAGAACAAAGTATTTCCAAATACTGTAGAGTCGCTTCCACGAAAGTCCTATGGTTGTATGGTTAACTTGGTTCCGGTGTTGGCTGATCTCAATT

ACTGACTCCCTGTCCCGTGTTCTGTCTGTGACTTAATGTAACTGTTATCACCGCGCTTGTGACCTTTTACGTCATTGTTTTGTGTTCACCCTCTTTTTTA

AAAAAAAATATATTAATAAAC
Translation
MGPRRLLIVALGLSLCGPLLSSRVPMSQPE - UNI26275 - ESERTDATVNPRSFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPP

HTPPPPFISEDASGYLTSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSGMCRFATA

AFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSAIFFL

VPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQR

HLYSILCCKESSDPNSCNSTGQLMPSKMDTCSSHLNNSIYKKLLA

For any suggestions or comments, please send an email to unitrap@crg.es