Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048379 (Socs4)
Chromosomal location
Chr 14: 47896818 - 47911266 (+)
Description
suppressor of cytokine signaling 6 Gene [Source:MGI (curated);Acc:Socs4-001]
RefSeq_dna
NM_080843 
RefSeq_peptide
NP_543119.2 
UniGene
Mm.425886 
MGI
MGI:1914546 
Uniprot/SWISSPROT
Q91ZA6 
Uniprot/SPTREMBL
Q149F7 Q149F8 Q6PG92 Q8C1J7 
Human Ortholog
ENSG00000180008 (SOCS4)
Omim not available
UniTrap UNI285
Vector Insertion
Chr 14: 47896897 - 47909191
Public Clones GC0459 (tigem) CMHD-GT_533H2-5S (cmhd) CMHD-GT_447C9-3 (cmhd)
Private Clones OST359380 (lexicon) OST133726 (lexicon) OST67864 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111789
Sequence
ATCCGTCCAGAAAGTGCCCAGAAGAAACTTCCTCTTAGAAAAGCTGAAAACACAATATTTATAACACTGGAAATTGTAAAGAATTTGTTTAAAATGGCTG

AAAACAATAGTAAAAATGTAGATGTACGGCCTAAAACAAGTCGGAGTCGAAGTGCTGACAGGAAGGATGGTTATGTGTGGAGTGGAAAGAAGTTGTCTTG

GTCCAAAAAGAGTGAGAGTTGTTCTGAATCTGAAGCCATAGGTACTGTTGAGAATGTTGAAATTCCTCTAAGAAGCCAAGAAAGGCAGCTTAGCTGTTCG

TCCATTGAGTTGGACTTAGATCATTCCTGTGGGCATAGATTTTTAGGCCGATCCCTTAAACAGAAACTGCAAGATGCGGTGGGGCAGTGTTTTCCAATAA

AGAATTGTAGTGGCCGACACTCTCCAGGGCTTCCATCTAAAAGAAAGATTCATATCAGTGAACTCATGTTAGATAAGTGCCCTTTCCCACCTCGCTCAGA

TTTAGCCTTTAGGTGGCATTTTATTAAACGACACACTGTTCCTATGAGTCCCAACTCAGATGAATGGGTGAGTGCAGACCTGTCTGAGAGGAAACTGAGA

GATGCTCAGCTGAAACGAAGAAACACAGAAGATGACATACCCTGTTTCTCACATACCAATGGCCAGCCTTGTGTCATAACTGCCAACAGTGCTTCGTGTA

CAGGTGGTCACATAACTGGTTCTATGATGAACTTGGTCACAAACAACAGCATAGAAGACAGTGACATGGATTCAGAGGATGAAATTATAACGCTGTGCAC

AAGCTCCAGAAAAAGGAATAAGCCCAGGTGGGAAATGGAAGAGGAGATCCTGCAGTTGGAGGCACCTCCTAAGTTCCACACCCAGATCGACTACGTCCAC

TGCCTTGTTCCAGACCTCCTTCAGATCAGTAACAATCCGTGCTACTGGGGTGTCATGGACAAATATGCAGCCGAAGCTCTGCTGGAAGGAAAGCCAGAGG

GCACCTTTTTACTTCGAGATTCAGCGCAGGAAGATTATTTATTCTCTGTTAGTTTTAGACGCTACAGTCGTTCTCTTCATGCTAGAATTGAGCAGTGGAA

TCATAACTTTAGCTTTGATGCCCATGATCCTTGTGTCTTCCATTCTCCTGATATTACTGGGCTCCTGGAACACTATAAGGACCCCAGTGCCTGTATGTTC

TTTGAGCCGCTCTTGTCCACTCCCTTAATCCGGACGTTCCCCTTTTCCTTGCAGCATATTTGCAGAACGGTTATTTGTAATTGTACGACTTACGATGGCA

TCGATGCCCTTCCCATTCCTTCGCCTATGAAATTGTATCTGAAGGAATACCATTATAAATCAAAAGTTAGGTTACTCAGGATTGATGTGCCAGAGCAGCA

GTGATGCGGAGAGGTTAGAATGTCGACCTGCATACATATTTTCATTTAATATTTTATTTTTCTTATGCCTCTTTGAATTTTTGTACAAAGGCAGTTGAAT

CAAATAAAACTGTGCCCTAAGTTTTAATTCCAGATCAATTTATTTTTTTTATGATACACTTGTTATATATTTTTAAGCAGGTGTTTGGTTTTGTTTTTAC

CATATAAATTTACATATGGTCCAGGCATATTTACAATTTCAAGGCATTGCATATACATTTGAATATTCTGTATTTTTTAAATAATCTTTTGTTCTTTCCT

ATGTGTGAAATATTTTGCTAATCTATGCTATCAGTATTCTTGTATGACCGAATAGTTACCTATTCTCTTTTCATCTTGAAGATTTTCAGTAAAGAGTGTT

GTAATCAATCCATTATAATGTAATTGACTTTTGTAATTTGCCAATAGGAGTGTTAAACAACAAAATGATTTAAAATGAAACTTAATGTATTTTCATTTTA

AATATTAACTAAACCAAGTTTGTTTGTTAGTTATTCTAGCCAATAAGAAAAGAGAATGTAGCATCCTAGAGGTGTATTTGTTCTGCAGTTTGGCAGGACC

GTCAGTTAGTCCAAATAAACATCCCCTCAGCGTGGAGGCGAATGGAACCTG
Translation
MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSESEAIGTVENVEIPLRSQERQLSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCF

PIKNCSGRHSPGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRHTVPMSPNSDEWVSADLSERKLRDAQLKRRNTEDDIPCFSHTNGQPCVITANSA

SCTGGHITGSMMNLVTNNSIEDSDMDSEDEIITLCTSSRKRNKPRWEMEEEILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGK

PEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTY

DGIDALPIPSPMKLYLKEYHYKSKVRLLRIDVPEQQ
Transcript ENSMUST00000065562
Sequence
GCTTGAGCGAGCGCCGGGTGATGGCGGTGGTGATGGCGGCAGGCGCTCGGACAGCTCCGCTTGAGCTGAGCTCGGAGAG - UNI285 - ATCCGTCCA

GAAAGTGCCCAGAAGAAACTTCCTCTTAGAAAAGCTGAAAACACAATATTTATAACACTGGAAATTGTAAAGAATTTGTTTAAAATGGCTGAAAACAATA

GTAAAAATGTAGATGTACGGCCTAAAACAAGTCGGAGTCGAAGTGCTGACAGGAAGGATGGTTATGTGTGGAGTGGAAAGAAGTTGTCTTGGTCCAAAAA

GAGTGAGAGTTGTTCTGAATCTGAAGCCATAGGTACTGTTGAGAATGTTGAAATTCCTCTAAGAAGCCAAGAAAGGCAGCTTAGCTGTTCGTCCATTGAG

TTGGACTTAGATCATTCCTGTGGGCATAGATTTTTAGGCCGATCCCTTAAACAGAAACTGCAAGATGCGGTGGGGCAGTGTTTTCCAATAAAGAATTGTA

GTGGCCGACACTCTCCAGGGCTTCCATCTAAAAGAAAGATTCATATCAGTGAACTCATGTTAGATAAGTGCCCTTTCCCACCTCGCTCAGATTTAGCCTT

TAGGTGGCATTTTATTAAACGACACACTGTTCCTATGAGTCCCAACTCAGATGAATGGGTGAGTGCAGACCTGTCTGAGAGGAAACTGAGAGATGCTCAG

CTGAAACGAAGAAACACAGAAGATGACATACCCTGTTTCTCACATACCAATGGCCAGCCTTGTGTCATAACTGCCAACAGTGCTTCGTGTACAGGTGGTC

ACATAACTGGTTCTATGATGAACTTGGTCACAAACAACAGCATAGAAGACAGTGACATGGATTCAGAGGATGAAATTATAACGCTGTGCACAAGCTCCAG

AAAAAGGAATAAGCCCAGGTGGGAAATGGAAGAGGAGATCCTGCAGTTGGAGGCACCTCCTAAGTTCCACACCCAGATCGACTACGTCCACTGCCTTGTT

CCAGACCTCCTTCAGATCAGTAACAATCCGTGCTACTGGGGTGTCATGGACAAATATGCAGCCGAAGCTCTGCTGGAAGGAAAGCCAGAGGGCACCTTTT

TACTTCGAGATTCAGCGCAGGAAGATTATTTATTCTCTGTTAGTTTTAGACGCTACAGTCGTTCTCTTCATGCTAGAATTGAGCAGTGGAATCATAACTT

TAGCTTTGATGCCCATGATCCTTGTGTCTTCCATTCTCCTGATATTACTGGGCTCCTGGAACACTATAAGGACCCCAGTGCCTGTATGTTCTTTGAGCCG

CTCTTGTCCACTCCCTTAATCCGGACGTTCCCCTTTTCCTTGCAGCATATTTGCAGAACGGTTATTTGTAATTGTACGACTTACGATGGCATCGATGCCC

TTCCCATTCCTTCGCCTATGAAATTGTATCTGAAGGAATACCATTATAAATCAAAAGTTAGGTTACTCAGGATTGATGTGCCAGAGCAGCAGTGATGCGG

AGAGGTTAGAATGTCGACCTGCATACATATTTTCATTTAATATTTTATTTTTCTTATGCCTCTTTGAATTTTTGTACAAAGGCAGTTGAATCAAATAAAA

CTGTGCCCTAAGTTTTAATTCCAGATCAATTTATTTTTTTTATGATACACTTGTTATATATTTTTAAGCAGGTGTTTGGTTTTGTTTTTACCATATAAAT

TTACATATGGTCCAGGCATATTTACAATTTCAAGGCATTGCATATACATTTGAATATTCTGTATTTTTTAAATAATCTTTTGTTCTTTCCTATGTGTGAA

ATATTTTGCTAATCTATGCTATCAGTATTCTTGTATGACCGAATAGTTACCTATTCTCTTTTCATCTTGAAGATTTTCAGTAAAGAGTGTTGTAATCAAT

CCATTATAATGTAATTGACTTTTGTAATTTGCCAATAGGAGTGTTAAACAACAAAATGATTTAAAATGAAACTTAATGTATTTTCATTTTAAATATTAAC

TAAACCAAGTTTGTTTGTTAGTTATTCTAGCCAATAAGAAAAGAGAATGTAGCATCCTAGAGGTGTATTTGTTCTGCAGTTTGGCAGGACCGTCAGTTAG

TCCAAATAAACATCCCCTCAGCGTGGAGGCGAATGGAACCTGTGCTCCTTTCTTACGGGAAGCTTT
Translation
 - UNI285 - MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSESEAIGTVENVEIPLRSQERQLSCSSIELDLDHSCGHRFLGRSL

KQKLQDAVGQCFPIKNCSGRHSPGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRHTVPMSPNSDEWVSADLSERKLRDAQLKRRNTEDDIPCFSHT

NGQPCVITANSASCTGGHITGSMMNLVTNNSIEDSDMDSEDEIITLCTSSRKRNKPRWEMEEEILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVM

DKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQH

ICRTVICNCTTYDGIDALPIPSPMKLYLKEYHYKSKVRLLRIDVPEQQ

For any suggestions or comments, please send an email to unitrap@crg.es