Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048402 (Gli2)
Chromosomal location
Chr 1: 120730638 - 120950196 (-)
Description
GLI-Kruppel family member GLI2 Gene [Source:MGI Symbol;Acc:MGI:95728]
RefSeq_dna
NM_001081125 
RefSeq_peptide
NP_001074594.1 
UniGene
Mm.273292 
MGI
MGI:95728 
Uniprot/SPTREMBL
A5A9W4 A5A9W5 A5AA25 A5AA26 Q0VGT2 Q0VGV1 Q8BKI7 Q8K0K3 
Human Ortholog
ENSG00000074047 (GLI2)
Omim 610829 - HOLOPROSENCEPHALY 9  
UniTrap UNI9266
Vector Insertion
Chr 1: 120898784 - 120949878
Public Clones (sanger) XG418 (baygenomics) 5SE120C03 (ggtc) 5SD111A08 (ggtc) D018B04 (ggtc)
3SD078C02 (ggtc) 3SE068A10 (ggtc) 5SD066B04 (ggtc) 3SD018A08 (ggtc)
5SE088G06 (ggtc) 5SD088B09 (ggtc) P092H01 (ggtc) 3SD068H03 (ggtc)
3SD018B04 (ggtc) 3SE128A06 (ggtc) 5SP127A01 (ggtc) 5SD078C02 (ggtc)
5SE068A10 (ggtc) 3SD088B09 (ggtc) P108A06 (ggtc) 5SD066C04 (ggtc)
5SD018A08 (ggtc) CMHD-GT_536E10-5S (cmhd) Ayu21-T281 (egtc) IST15005G3 (tigm)
IST14388H9 (tigm) IST10491E10 (tigm) IST12092D11 (tigm) IST10061G7 (tigm)
IST10805E7 (tigm) IST10462B10 (tigm) IST12226G3 (tigm) IST14449H5 (tigm)
IST14671C6 (tigm)
Private Clones OST460038 (lexicon) OST457289 (lexicon) OST446043 (lexicon) OST406389 (lexicon)
OST368186 (lexicon) OST350767 (lexicon) OST303168 (lexicon) OST239972 (lexicon)
OST226888 (lexicon) OST222951 (lexicon) OST222655 (lexicon) OST193931 (lexicon)
OST182294 (lexicon) OST170270 (lexicon) OST169773 (lexicon) OST166600 (lexicon)
OST146774 (lexicon) OST145856 (lexicon) OST136050 (lexicon) OST134187 (lexicon)
OST125100 (lexicon) OST114743 (lexicon) OST45035 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13
Vector Insertion
Chr 1: 120786979 - 120898616
Public Clones GC0047 (tigem) GC0568 (tigem) GC0252 (tigem) (sanger) CSD115 (baygenomics)
XG045 (baygenomics) CSG015 (baygenomics) D053E01 (ggtc) W085C03 (ggtc)
5SD109C01 (ggtc) A048A08 (ggtc) 5SD053E01 (ggtc) 3SD109C01 (ggtc)
A022C05 (ggtc) 3SD053E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38353
Vector Insertion
Chr 1: 120764555 - 120786979
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9512
Vector Insertion
Chr 1: 120752215 - 120763148
Public Clones RRA060 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062483
Sequence
AATGAGACTTCGAGGAGGAGCGGGAGGCGGCGGCGGCGGCTACAGAGGACGCGGAGGAAGGCGAGGAGGAGCCAGAGGAAGGAGCACGGGTCGTGCGTAG

CATCGCAGCCGCCCGGAGCTGCTGGCCTGGTGTCCTTAGGGACTGCCCGAGTCCCCCGCCCGCCTTGGTCCCCTCCTCTGCCTGGCCAGCCCCGCCCCGG

CAGCCGGAGCCCCCGCACTCGGCAGCCCCACTCCAGCCAAGTTGGGATGGGGCCCTGCAACCACTGCCCGGCGCCCGAGAGGCCACCTGCATGCTAGAGG

CAAACTTTTGTCTCCTCG - UNI9266 - GGTCCGCCACCAAAGAGTATGAGCCTCTGAGATGGAGACTTCTGCCCCAGCCCCTGCACTGGAGAAGAA

AGAAGCCAAGAGTGGTCTCTTGGAGGACAGCAGCTTCCCCGACCCAGGGAAAAAGGCCTGTCCTCTGGCGGTGGCCGCAGCTGTAGCCGCCCACGGAG -

 UNI13 - TTCCTCAGCAGCTCCTGCCGGCTTTCCACGCGCCTTTGCCGATTGACATGAGACACCAGGAGGGAAGGTACCATTATGACCCTCACTCTGT

CCACAGTGTACACGG GCCTCCCACCCTAAGTGGCAGCCCTGTCATCTCAGATATCTCCTTGATACGACTTTCTCCACACCCTGCTGGCCCTGGAGAGTC

ACCCTTCAGCGCCCACCACCCCTACGTGAACCCCCATATGGAGCACTACCTCCGGTCTGTGCACAGCAGCCCCACACTCTCAATGATCTCTGCCGCCAGG

GGCCTCAGCCCTGCTGATG TGGCCCACGAACATCTGAAAGAGAGGGGACTCTTTAGCCTCGCAGCCCCAGGCACCAACCCTTCAGACTATTACCACCAG

ATGACCCTCATGGCAAGCCACCCCACCCCTTATGGGGACCTTCTAATGCAGAGCGGGGGTGCTGCTAGCGCACCCCATCTCCATGACTACCTCAACCCTG

TGGATG - UNI9512 - CATCACGATTCTCTAGTCCACGTGTGACCCCACGACTGAGCCGCAAGCGGGCTCTGTCCATCTCCCCGCTCTCAGATGCCA

GCCTCGACCTACAACGCATGATTCGGACCTCTCCCAACTCGCTGGTAGCTTACATCAACAACTCCAGGAGCAGCTCAGCAGCCAGTGGCTCTTATGGACA

TCTGTCTGCTGGTGCCCTCAG CCCAGCCTTCACTTTTCCCCACCCCATCAATCCTGTGGCCTACCAGCAGATCCTGAGCCAGCAGCGGGGCCTGGGCTC

AGCCTTTGGACACACACCACCCCTGATCCAGCCTTCACCCACCTTCTTGGCCCAGCAGCCCATGACTCTCACCTCCATCAGCACCATGCCTACCCAACTC

AGCAGCAGTAGCAGCAACTGTCTAAATGATGCCAACCAG AACAAGCAGAACAGCGAGTCAGCTGTGAGCAGCACCGTGAACCCCATCACCATTCATAAG

CGGAGCAAGGTCAAGACTGAGGCTGAGGGCCTGCGTCCAGCATCCCCGCTTGGACTGACACAG GAGCAGCTGGCCGATCTCAAGGAAGACCTGGACAGG

GATGACTGTAAGCAGGAGGCCGAGGTGGTCATCTACGAGACCAACTGCCACTGGGCAGACTGCACCAAGGAGTATGACACACAGGAGCAGCTGGTGCAT 

CATATCAACAATGAACACATCCACGGGGAGAAGAAGGAGTTCGTGTGCCGCTGGCAGGCCTGCACGAGAGAGCAGAAGCCCTTCAAGGCCCAGTACATGC

TGGTTGTTCACATGCGCAGACACACGGGTGAGAAGCCACACAAGTGCACG TTCGAAGGCTGTTCCAAGGCCTACTCTCGCCTGGAGAACCTGAAGACAC

ACCTGCGTTCACACACAGGAGAGAAGCCATATGTGTGTGAACACGAAGGCTGTAACAAAGCCTTCTCCAATGCCTCAGACCGCGCCAAGCACCAGAACCG

CACTCACTCCAATGAG AAACCCTACATCTGCAAGATCCCAGGCTGCACCAAGAGGTACACAGACCCCAGCTCACTCCGCAAGCATGTGAAGACTGTCCA

TGGGCCAGACGCCCATGTCACCAAGAAACAGCGTAATGATGTGCATGTCCGTGCTCCACTGCTCAAGGAGAATGGGGATAATGAGGCCAGCGCCGAGCCA

GGTGGCCGGGGACCTGAGGAGAGTGTGGAGGCCAGTAGCACCAGCCACACTGTGGAGGACTGCCTACATATCAAAGCCATCAAGACAGAGAGCTCCGGG 

CTTTGTCAGTCCAGCCCCGGGGCCCAGTCATCCTGCAGCAGCGAGCCCTCTCCCCTGGGCAGTGCCCCCAACAATGACAGTGGCATGGAGATGCCGGGGA

CAGGGCCTGGGAGTCTGGGAGACCTGACAGCACTGGCTGACACGTGTCCAGGAGCTGACACCTCAGCCCTGGCTGCACCCTCCACTGGTGGCCTGCAGCT

GCGCAAACACATGAGCACCGTGCATCGCTTTGAGCAGCTGAAGAGAGAGAAGCTCAAGTCACTGAAGGATTCCTGCTCGTGGGCCGGCCCAGCTCCACAC

ACCCGCAACACCAAGCTGCCTCCCCTTCCAGTCAATG GTTCTGTCCTGGAAAACTTCAACAATACAGGGGGCGGTGGACCGGCAGGACTGCTGCCCAGC

CAGCGGCTACCAGAGCTGACCGAAGTGACGATGCTGAGCCAGCTGCAGGAACGAAGAGACAGCTCCACCAGCACCATGAGCTCGGCCTACACTGTGAGCC

GCCGCTCCTCTGGCATCTCCCCATACTTCTCTAGCCGTCGCTCCAGCGAGGCTTCGCCTCTCGGTGGCCTACGCCCGCACAACGCCAGCTCAGCAGACTC

CTATGACCCCATCTCCACAGATGCCTCTCGGCGCTCCAGTGAAGCCAGCCAGTGCAGTGGCGGTGGCCCAGGGCTGCTCAACCTCACACCTGCGCAGCAG

TACAACCTGCGTGCCAAGTACGCAGCGGCCACAGGTGGACCACCGCCCACGCCACTGCCGGGCCTCGATCGTGTAAGCCTTCGTACCCGCCTGGCCTTGC

TGGATGCTCCTGAGCGTGCACTTCCTGGTGCCTGCCCACATCCACTGGGGCCACGGCGTGGCAGCGATGGGCCTACCTATAGCCATGGTCATGGCCATGG

CTACGCAGGTGCGGCTCCAGCATTCCCCCACGAGGGGCCAAACAGCAGCACACGGCGGGCCAGCGACCCTGTGCGGCGCCCTGACCCCCTTATTCTGCCT

CGAGTGCAACGTTTCCACAGTACCCACAACATGAATCCAGGTTCACTGCCACCCTGCGCTGATCGGCGTGGCCTGCACGTACAGAGCCACCCCAGCGTAG

ACAGCAACCTGACCCGCAACGCCTACTCTCCCAGACCCCCTAGCATCAATGAGAACGTGGTGATGGAGGCCGTGGCTGCTGGGGTAGACGGCCCAGGGCT

AGAGTGCGACCTGGGGCTGGTGGAGGATGAGCTGGTGCTGCCAGATGATGTGGTACAGTACATCAAGGCTCACACCGGTGGTACCTTGGATGACGGCATT

CGGCAGGGGTATCCCACAGAAGGTACTGGCTTCCCCGAGAACTCTAAGCTGCCCAGTCCTGGGCTACAAGGCCACCGCAGGCTAGCAGCTGCCGACTCCA

ACATGGGTCCTTCTGCTCCTGGACTCGGGGGCTGCCAGCTGAGCTACAGCCCCTCCTCCAACCTCAACAAGAGCAACATGCCTGTGCAGTGGAATGAGGT

GAGTTCTGGCACCGTGGATGCCCTGCCTACCCAGGTGAAGCCACCTCCTTTCCCTCACAGCAACCTGGCTGTGGTCCAACAGAAGCCAGCCTTTGGCCAG

TATCCAGGATATAATCCACAATCCGTGCAGAGCAGCTCCGGAGGTCTAGACAGCACCCAGCCGCACCTACAGCTTCGAGGAGCCCCCTCTGCATCAAGAG

GGAGCTACACGCAACAGCCTCGACAGCCAGCTGCAGGCAGTCAGTGCCTGGGTATGAGTGCGGCCATGAGCCCGCAGGCCAGCTACAGCCAAGCCCACCC

CCAGCTGAGCCCAAACATTGTCAGCGGATCTCTGAACCAGTTTTCTCCCTCCTGCAGCAATATGGCAGCCAAGCCCAGCCACCTGGGACTCCCTCAGCAA

ATGGAAGTTGTCCCCAATGCCACCATCATGAATGGCCATCAACGGGAGCACGGGGTCCCCAATTCATCCCTGGCTGCGGTGTCACAACCTCACCCAGTCC

TGAGCTATCCCCAGCAGGACAGCTACCAACAGGGCTCCAACCTTCTGTCATCCCATCAGCCTGGCTTCATGGAGTCCCAGCAGAACGCGGGCTTTGGTCT

CATGCAGCCTCGGCCACCCCTGGAACCCAACACGGCCAGCCGTCACCGTGGAGTACGTTCTGGGCAACAGCAGTTGTATGCCAGGACCACTGGCCAAGCC

ATGGTCACATCAGCCAACCAAGAGACAGCAGAAGCTATGCCCAAGGGACCAGCAGGGACCATGGTATCCCTAGCTCCTCAGCCATCTCAGGACACAGGGC

GGGCACAAGATCAGAACACGCTATACTACTATGGCCAGATCCACATGTATGAACAGAATGGAGGCTGCCCAGCCGTGCAGCCCCAGCCGCCACAACCACA

AGCTTGCTCAGACAGTATCCAGCCTGAGCCTTTGCCTTCACCGGGAGTCAACCAGGTGTCTAGCACCGTGGACTCCCAGCTCCTGGAGCCCCCCCAGATT

GACTTTGATGCCATCATGGATGATGGTGATCACTCGAGTTTGTTTTCTGGTGCACTGAGCCCAACCCTTCTCCACAATCTCTCCCAGAATTCCTCACGCC

TCACCACACCCCGGAATTCCTTGACACTGCCCTCCATCCCTGCGGGCATCAGCAACATGGCCGTGGGCGACATGAGTTCCATGCTCACCAGCCTGGCTGA

AGAGAGCAAGTTTTTAAACATGATGACCTAAAGGCCCTGGCTCCTGGCACAGGAGACCTGAGCAACACTAGCCCCTTGGAATATGAGGGTCTAGTCTGTT

CTCATTGTCCCAAAGTGTTAACTAGGCCTGAGAGGGGTTGGGCAATGGCCAACTCCAAATGACAGCTCTGGGCCATGCCCAGGGGTCTTCTTGCAGATGT

TTTAAGAAAAGATTAAGGGGCATCCTCTCTGCTGTTTGGCCTATTTGGGGGGGGAGGGGACACCCAAAGTCTTATTCAAAAAGAAACTCGTTCACATGAC

GCTTGCCAGCCTCTGGTGTTTGTGAGATTCCCGGGTTCTGGCTCCTTTGCCTCTATCATTCAGCTAATGAGAGAGAACTTTGGCCAGGGGCTTTCCAAGT

ACACGCCCAAAGAGGGGAGGGGAGCCACTCTGGGTTTGAATCTGAGACCATGCTGGATATTCTCTGCTCTGAGAAGATGAGTTTGCCATTCTGCCACCTG

GGAGGAAAAGGGATTACTGTTTCCCCTGGATTCTTCCATGAAGCTCGTCAAGGTTGCTCACCACGGAGGAGAAAGGCGCATCCCCCGGGATATTGTAGTC

TCCTCAGTTACTTGCTAACATCTCCATTTCCTTAGGTAGAGTGGGACCAGCAGATTTCCTAAATGGAGAAGAATTAATAAAACACGTATTTTACTATTGG

GGGGGGTACAGGGTCTCTCCTGGCCTGTTTACAGTGTTCTGAGGTATACAGTGAAGCCCTCCCTGGGAAGAAGACTTGCGTCTACATGCCTTGGGTTGCT

GTGGACTAGGAATAGGCAGGGCCTCGAGGTGGAAGAGGCCTTCCCCAGGAAAAGGAAGTCATATGTTTACCCGCTCCTATTTCTCCAGTGCACTATCTGA

CCACTCTCTCATGGGAGATCCCAGGGCTCCTCCACACCGGCTGGTGGCCAGCAGACAACCCTGAGCGACCACCTGCAGCCTCCACACTTTCTGGTCCCCT

GACCTCTACCCTCCTCTCCAGGTTATTTGGCATGGACCAGTGATGACATGCATGGTTTGTGGTTGAGCGGAAGGTTGAAGGCATTGATTCTTGGACTTTG

AGGAACTCTTAACTGAATTTGCTTGTTCAGTATGGCCTGGCCCCAGATAAGAAATGGCATGTGGAAACTGACTCCAAAAAGAGTCAGTCAGAGCGCACTG

CAGGGTGAACCCATGCCTCCACCACCACAGACATGTGCGTATCCCAAACCTGTTCCTTTGAGTTAACAGAAACTTTTGCCAACCAAACCTCACCAATCAG

AGCTTCCTTCTGGCCATGACCTTGGCTGTGGTGAGGAGCTTCTTAACAGAGTCTGGACCCTCTGTGTCCCAGGGCAGCAAACTTCTCTGTTTACAACCCA

GAGACAGGACCAACTCCAAATGACAGCTCTGGGCCATGCCCCTGGGTCTCTGGCTCTTGTGGTGTGGACTCATTGCCTGACATAGACCCTAGCTTCCCAT

TCTGTCTGTATCTATTTTGTGTAGACATCGTCTTGCCTGAATAGACTGTGGGTGAATCCAAATTTGGTCCAGCCAAATTTATATTGCCAAACATTTTTAG

CTTTTTCTACATGCTATAAATTGAGATGACATGCTCAACTTGTAAATAAGTCTTTTTTGTACATTAAAAGTAATTTTTTCATAATTTATCTTGTTGATCT

GCTTTTCCCTTGACAGTAGTTAATGAGAATCCAGGCAGTAAATTTGGTGCATTTG
Translation
 - UNI9266 - METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGV - UNI13 - VPQQLLPAFHAPLPIDMRHQEGRYHYDPHS

VHSVHG GPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYVNPHMEHYLRSVHSSPTLSMISAARGLSPADV VAHEHLKERGLFSLAAPGTNPSD

YYHQMTLMASHPTPYGDLLMQSGGAASAPHLHDYLNPVDA - UNI9512 - ASRFSSPRVTPRLSRKRALSISPLSDASLDLQRMIRTSPNSLVAYIN

NSRSSSAASGSYGHLSAGALS SPAFTFPHPINPVAYQQILSQQRGLGSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLSSSSSNCLNDANQ NKQN

SESAVSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQ EQLADLKEDLDRDDCKQEAEVVIYETNCHWADCTKEYDTQEQLVH HINNEHIHGEKKEFVC

RWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCT FEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNE KPYICKIPG

CTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDNEASAEPGGRGPEESVEASSTSHTVEDCLHIKAIKTESSG LCQSSPGAQSSCSS

EPSPLGSAPNNDSGMEMPGTGPGSLGDLTALADTCPGADTSALAAPSTGGLQLRKHMSTVHRFEQLKREKLKSLKDSCSWAGPAPHTRNTKLPPLPVNG 

GSVLENFNNTGGGGPAGLLPSQRLPELTEVTMLSQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSYDPISTDASRRS

SEASQCSGGGPGLLNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLRTRLALLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGYAGAAPAFPHEG

PNSSTRRASDPVRRPDPLILPRVQRFHSTHNMNPGSLPPCADRRGLHVQSHPSVDSNLTRNAYSPRPPSINENVVMEAVAAGVDGPGLECDLGLVEDELV

LPDDVVQYIKAHTGGTLDDGIRQGYPTEGTGFPENSKLPSPGLQGHRRLAAADSNMGPSAPGLGGCQLSYSPSSNLNKSNMPVQWNEVSSGTVDALPTQV

KPPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRGAPSASRGSYTQQPRQPAAGSQCLGMSAAMSPQASYSQAHPQLSPNIVSGSLN

QFSPSCSNMAAKPSHLGLPQQMEVVPNATIMNGHQREHGVPNSSLAAVSQPHPVLSYPQQDSYQQGSNLLSSHQPGFMESQQNAGFGLMQPRPPLEPNTA

SRHRGVRSGQQQLYARTTGQAMVTSANQETAEAMPKGPAGTMVSLAPQPSQDTGRAQDQNTLYYYGQIHMYEQNGGCPAVQPQPPQPQACSDSIQPEPLP

SPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQNSSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT

For any suggestions or comments, please send an email to unitrap@crg.es