Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048440 (Cyp4f16)
Chromosomal location
Chr 17: 32673545 - 32688739 (+)
Description
cytochrome P450, family 4, subfamily f, polypeptide 16 Gene [Source:MGI Symbol;Acc:MGI:1917351]
Human Ortholog
not available
Omim not available
UniTrap UNI35735
Vector Insertion
Chr 17: 32677361 - 32679682
Public Clones IST14174A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003416
Sequence
TGCTTTTCACAGGACTGGGGAGAAGGTCTTAGAGGACCAGCAGCTCCTGAGATAAG CAGGATGCTGCGGCTAAGTGTGTCTGGGCTGGACCTGGGCTCT

GTGGTGACCTCGTCATGGCATCTTCTGCTGCTTGGAGTGGCTTCCTGGATTTTGGCCAGAATCCTTGCCTGGACTTACTCATTCTATGAGAACTGCTCCC

GCCTCAGTTGTTTCCCTCAGCCTCCTAAAAAAAACTGGTTTTCAGGTCACTTGGGCATG ATCCAGAGCAATGAGGAAGGCATGCAGCTGGTTACCGAAA

TGGGCCAGACTTTCCAAGATGTCCATCTCTTTTGGCTGGGACCAGTGATCCCTGTGCTGAGGATTGTTGACCCTGCATTTGTTGCCCCCCTGCTCCAGGC

CCCAG - UNI35735 - CTTTGGTGGCCCCAAAGGACATGACATTTTTACGCTTCCTGAAGCCCTGGCTGG GGGATGGGCTCTTCCTGAGTTCAGGT

GACAAGTGGAGCCGCCATCGTCGACTGCTGACACCTGCCTTCCACTTTGATATCCTGAAGCCCTATGTGAAGATTTTTAACCAGAGTGTGAACATCATGC

AC GCCAAGTGGAAGCACCTATCCTCGGAAGGCAGTGCACGTCTGGAAATGTTTGAGCACATCAGCCTCATGACCTTGGACAGTCTGCAGAAATGCCTCT

TTGGCTTTGACAGCAACTGTCAGGA GTCTCCCAGTGAATACATTTCTGCCATCTTGGAACTCAGTTCCCTCATAATAAAAAGGTCACTTCAGCTCTTCT

TGTTCGTTGACTTCCTGTATTACCACACTGCTGATGGGCGGCGCTTCCGCAAGGCCTGTGACCTGGTGCACAACTTCACAGATGCTGTCATTAGGGAGAG

ACGGCACACTCTCTCCAGCCAAAACCATGATGAGTTCTTGAAGTCCAAGACTAAGTCTAAGACTCTGGATTTCATTGATGTTCTCTTGTTGGCCAAG GA

TGAACATGGAAAGGAGCTGTCAGATGAGGACATCCGGGCAGAGGCTGACACCTTTATGTTTGGAG GCCATGACACCACAGCCAGTGCACTCTCCTGGAT

CCTGTACAACCTGGCGAGGCACCCCGAATACCAGGAGCGCTGCCGGCAGGAGGTTCAGGAGCTGCTGAGGGACCGAGAGCCTGAGGAGATTGAATG GGA

CGACCTGGCCCAGCTACCCTTCCTGACCATGTGCATCAAGGAGAGTCTGCGGCTACATTCCCCAGTCATAGACCTCCTCCGCCGCTGCACCCGGGACATT

GTGCTACCTGATGGCCGGGTCATCCCTAAAG GGAACATCTGTGTCATCAGCATCTTTGGTATTCATCACAATCCATCAGTCTGGCCAGACCCTGAG GT

CTATGACCCCTTCCGCTTTGACCCAGAAAACCCACAGAAGAGGTCCCCTCTGGCTTTTATTCCCTTTTCTGCCGGGCCCAG GAACTGCATAGGACAGAC

TTTCGCCATGAGCGAGATGAAGGTGGCACTGGCGCTGACTCTGCTGCGCTTCCGCATCCTGCCTGATGACAAGGAGCCGCGCCGGAAGCCAGAGATAATC

CTGCGGGCGGAGGGCGGGTTGTGGCTGCGGGTGGAGCCTCTGAGCAAGGGCGCTCAGTGACCAGGTCTACTACTGTCTCAGTCACTTTCCTTTGCCAATC

CCAGAATAAGCGGAGTTTCACCCAGAGCCATCAGAGGGCGCTGCAGGATAACAGAGACTGTCTGGAAGCCTGGCTGAGAAAAGTCTGGGGCTGCTTTCTG

AGTCCAAGGGCCTTTCTGGGTAGCCCACAGGGCCTGCAGACTGATGAAGAGTTGCATGCACCCCAGCTCAAGAACGGCCTTTATTCTTTTAGCGATAGGG

AGGCACCATAGATGTTTGAGCAGGAGAGTTACAAGGTTTACTGGCATGTAACCTCCCACAAGTCTGAAGCAGGCTGAGCCAGACCTTGACTTTGCTGACA

CTAAGGAGATTACCTAGGGTGTAGCCTTCCTCCCTAGATTACTCTAGTGTTCAGCCATTTTCCCTGTTCCTCTTCAAGATACTGCTACGGTGCTGAGAGG

CCCCAGAGCTATTCAGGAGACTATGCCTGCAGCTGGCTCCAGGCTCCAAATTGAATTGGTGGGAATGGGCTTCCCCTCCTTTTTATAAGCGCATTCTCCA

TTAAACATTTGAACCTTGAAC
Translation
 MLRLSVSGLDLGSVVTSSWHLLLLGVASWILARILAWTYSFYENCSRLSCFPQPPKKNWFSGHLGM IQSNEEGMQLVTEMGQTFQDVHLFWLGPVIPV

LRIVDPAFVAPLLQAPA - UNI35735 - ALVAPKDMTFLRFLKPWLG GDGLFLSSGDKWSRHRRLLTPAFHFDILKPYVKIFNQSVNIMH AKWKH

LSSEGSARLEMFEHISLMTLDSLQKCLFGFDSNCQE ESPSEYISAILELSSLIIKRSLQLFLFVDFLYYHTADGRRFRKACDLVHNFTDAVIRERRHTL

SSQNHDEFLKSKTKSKTLDFIDVLLLAK DEHGKELSDEDIRAEADTFMFGG GHDTTASALSWILYNLARHPEYQERCRQEVQELLRDREPEEIEW WD

DLAQLPFLTMCIKESLRLHSPVIDLLRRCTRDIVLPDGRVIPKG GNICVISIFGIHHNPSVWPDPE VYDPFRFDPENPQKRSPLAFIPFSAGPR RNC

IGQTFAMSEMKVALALTLLRFRILPDDKEPRRKPEIILRAEGGLWLRVEPLSKGAQ

For any suggestions or comments, please send an email to unitrap@crg.es