Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048445 (Ccdc57)
Chromosomal location
Chr 11: 120687856 - 120794186 (-)
Description
coiled-coil domain containing 57 Gene [Source:MGI (curated);Acc:Ccdc57-001]
RefSeq_dna
NM_027745 
RefSeq_peptide
NP_082021.1 
MGI
MGI:1918526 
Uniprot/SWISSPROT
Q6PHN1 
Uniprot/SPTREMBL
Q9D3U5 
Human Ortholog
ENSG00000176155 (CCDC57)
Omim not available
UniTrap UNI19421
Vector Insertion
Chr 11: 120783249 - 120794029
Public Clones 5SE284F05 (ggtc) 3SE284F05 (ggtc)
Private Clones OST391433 (lexicon) OST356170 (lexicon) OST242007 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29841
Vector Insertion
Chr 11: 120740191 - 120743230
Public Clones E050F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28697
Vector Insertion
Chr 11: 120721941 - 120722451
Public Clones not available
Private Clones OST23224 (lexicon) OST20757 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12986
Vector Insertion
Chr 11: 120688239 - 120721714
Public Clones CMHD-GT_156F1-3 (cmhd) CMHD-GT_391G3-3 (cmhd) CMHD-GT_492D2-3 (cmhd) CMHD-GT_358A3-3 (cmhd)
CMHD-GT_131C9-3 (cmhd) CMHD-GT_414H3-3 (cmhd) CMHD-GT_382F9-3 (cmhd) CMHD-GT_479C3-3 (cmhd)
CMHD-GT_498A2-3 (cmhd) CMHD-GT_171C6-3 (cmhd) CMHD-GT_108B7-3 (cmhd) CMHD-GT_395A9-3 (cmhd)
CMHD-GT_542C4-3 (cmhd) CMHD-GT_450H8-3 (cmhd) CMHD-GT_353A3-3 (cmhd) CMHD-GT_149H1-3 (cmhd)
CMHD-GT_385G8-3 (cmhd) CMHD-GT_533F12-5S (cmhd) CMHD-GT_489G3-3 (cmhd) CMHD-GT_171D6-3 (cmhd)
CMHD-GT_120H2-3 (cmhd) CMHD-GT_414E10-3 (cmhd) CMHD-GT_533F12-3 (cmhd) CMHD-GT_489G7-3 (cmhd)
CMHD-GT_167G3-3 (cmhd) CMHD-GT_394G8-3 (cmhd) CMHD-GT_542C4-5S (cmhd) CMHD-GT_441H4-3 (cmhd)
CMHD-GT_358D2-3 (cmhd) CMHD-GT_151C4-3 (cmhd) CMHD-GT_439F6-3 (cmhd) CMHD-GT_376E7-3 (cmhd)
CMHD-GT_542C4-3S (cmhd) CMHD-GT_459H10-3 (cmhd) CMHD-GT_152A11-3 (cmhd) CMHD-GT_103B2-3 (cmhd)
CMHD-GT_405A3-3 (cmhd) CMHD-GT_543D7-3 (cmhd) CMHD-GT_451G3-3 (cmhd) PST21379-NL (escells)
PSTVUpb20f10 (vanderbilt) B64 (vanderbilt) PSTVUpb17e5 (vanderbilt) PSTVUpb17d9 (vanderbilt)
PSTVUpb15f1 (vanderbilt) B70 (vanderbilt) PSTVUpb17e2 (vanderbilt) PSTVUpb20c2 (vanderbilt)
PSTVUpb16b2 (vanderbilt) PSTVUpb18a7 (vanderbilt) PSTVUpb17e10 (vanderbilt)
IST14729C6 (tigm) IST10822F8 (tigm) IST14625C1 (tigm) IST14757C10 (tigm)
IST10742B11 (tigm) IST14392C10 (tigm) IST14374G4 (tigm) IST14939G10 (tigm)
IST14332D6 (tigm) IST12660F6 (tigm) IST11385E12 (tigm)
Private Clones OST453336 (lexicon) OST391560 (lexicon) OST356937 (lexicon) OST320862 (lexicon)
OST318073 (lexicon) OST303546 (lexicon) OST299501 (lexicon) OST296814 (lexicon)
OST285267 (lexicon) OST281847 (lexicon) OST257207 (lexicon) OST219727 (lexicon)
OST127655 (lexicon) OST115480 (lexicon) OST113171 (lexicon) OST107809 (lexicon)
OST87429 (lexicon) OST84466 (lexicon) OST47726 (lexicon) OST31553 (lexicon)
OST31365 (lexicon) OST29828 (lexicon) OST29372 (lexicon) OST29297 (lexicon)
OST28830 (lexicon) OST28811 (lexicon) OST28706 (lexicon) OST28468 (lexicon)
OST28342 (lexicon) OST28288 (lexicon) OST28245 (lexicon) OST28063 (lexicon)
OST28048 (lexicon) OST28021 (lexicon) OST27805 (lexicon) OST27594 (lexicon)
OST27537 (lexicon) OST27470 (lexicon) OST27436 (lexicon) OST27391 (lexicon)
OST27316 (lexicon) OST27309 (lexicon) OST27258 (lexicon) OST27136 (lexicon)
OST27027 (lexicon) OST26600 (lexicon) OST26452 (lexicon) OST26074 (lexicon)
OST25997 (lexicon) OST25560 (lexicon) OST25360 (lexicon) OST24985 (lexicon)
OST24757 (lexicon) OST24642 (lexicon) OST24504 (lexicon) OST24014 (lexicon)
OST23826 (lexicon) OST23819 (lexicon) OST23431 (lexicon) OST23392 (lexicon)
OST23168 (lexicon) OST23055 (lexicon) OST22869 (lexicon) OST22620 (lexicon)
OST22233 (lexicon) OST22012 (lexicon) OST21724 (lexicon) OST21211 (lexicon)
OST21113 (lexicon) OST21060 (lexicon) OST20988 (lexicon) OST20763 (lexicon)
OST20470 (lexicon) OST20404 (lexicon) OST20316 (lexicon) OST20299 (lexicon)
OST20233 (lexicon) OST20230 (lexicon) OST19997 (lexicon) OST19952 (lexicon)
OST19693 (lexicon) OST19620 (lexicon) OST19508 (lexicon) OST19386 (lexicon)
OST19210 (lexicon) OST19204 (lexicon) OST19139 (lexicon) OST19061 (lexicon)
OST18948 (lexicon) OST18859 (lexicon) OST18665 (lexicon) OST18635 (lexicon)
OST18513 (lexicon) OST18401 (lexicon) OST18398 (lexicon) OST18363 (lexicon)
OST18174 (lexicon) OST17555 (lexicon) OST17157 (lexicon) OST16964 (lexicon)
OST16420 (lexicon) OST15867 (lexicon) OST15848 (lexicon) OST15417 (lexicon)
OST14342 (lexicon) OST14273 (lexicon) OST14109 (lexicon) OST13948 (lexicon)
OST13838 (lexicon) OST13834 (lexicon) OST13544 (lexicon) OST13353 (lexicon)
OST13325 (lexicon) OST13230 (lexicon) OST13038 (lexicon) OST12895 (lexicon)
OST12692 (lexicon) OST12575 (lexicon) OST12464 (lexicon) OST12133 (lexicon)
OST11729 (lexicon) OST11426 (lexicon) OST11315 (lexicon) OST10703 (lexicon)
OST10341 (lexicon) OST10204 (lexicon) OST9720 (lexicon) OST9579 (lexicon)
OST8112 (lexicon) OST7814 (lexicon) OST7803 (lexicon) OST7722 (lexicon)
OST7688 (lexicon) OST7477 (lexicon) OST7389 (lexicon) OST5719 (lexicon)
OST5637 (lexicon) OST4260 (lexicon) OST4104 (lexicon) OST3741 (lexicon)
OST3092 (lexicon) OST1993 (lexicon) OST1545 (lexicon) OST865 (lexicon)
OST823 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056781
Sequence
CTGACTCCAGTCGCTATGGTAACGTGGCCCGCGCTGTAGGTTCGGGCGGGAGAGTGCTGGCGCTCGGAATCCTGGAGACCCGGGTCCCAGCTGGCGCAGC

TCTAGGTCGCACGCGGGAGACGAAGCTAATTCCGCTGGGACCGTCCTGGCACACGCG - UNI19421 - CCATCACCATGCTGCCGCTATGTTCAGAG

CGGGAACTGAATGAGCTTTTGGCTCGAAAGGAGGAGGAATGGCGAGTCCTCCAGGCCCACCGTGCGCAGCTGCAGGAGGCAGCTCTACAGGCTGCTCAGA

ACCGCCTGGAGGAGACACAGGGGAAGCTGCAACGCCTACAGGAGGACTTTGTTTACAACCTTCAGGTGCTGGAAGAGCGGGACCGGGAGCTGGAGCGCTA

TGATGTTGAGTTCACCCAGGCCCGCCAGCGGGAGGAGGCCCAACAAGCAGAGGCCAGTGAGCTCAAGATAGAGGTGGCCAAGCTGAAACAAGACCTCACC

AGGGAGGCCAGGCGAGTGGGGGAGCTGCAGCATCAGCATCAGCTAATGCTGCAGGAGCATCGCTTGGAGTTGGAGCGCGTCCACAG TGACAAGAACAGC

GAACTGGCCCACCAGCGGGAACAGAATGAGCGCCTGGAGTGGGAACTGGAGCGAAAACTGAAGGAACTCGATGGTGAACTTGCTCTGCAGAGACAG GAG

CTGCTGCTGGAGTTTGAATCTAAAATGCAGAGAAGAGAGCATGAGTTCCAGCTGAGGGCTGACGACATGAGCAACGTAGTCCTGACACATGAGCTCAAG 

ATAAAACTACTAAACAAAGAGCTGCAAGCTCTGAGAGACGCTGGAGCACGGGCAGCAGAGAGTCTGCAGAAGGCAGAAGCAGAACACGTGGAATTAGAGA

GGAAGCTGCAGGAGCGTGCCCGGGAACTCCAGGATCTGGAGGCCGTGAAGGACGCTCG GATAAAGGGCTTGGAGAAGAAGCTTTACTCGGCACAGCTGG

CCAAGAAGAAAGCTGAGGAGACTTTCAGGAGGAA ACATGAAGAGCTTGACCGTCAAGCCAGGGAGAAAGACACAGTGCTGGCGGCAGTGAAGCGCGCCC

ATGCAGAGGAGCTGCAGACGCTGGACGCCAAGGTGCTGGAGCTTCAGTTCCTCTGTGAAACCCTGGAGGGACAACTGCGCAGGGCTGAGTGCACAAGAGC

AGAGGACGCCAAGGAGAAGAACGCCCTTACTGACAA ATTTCGTGAAGATGCGGCAGCTCTGAAAGCTGCCTGGGACGCCCAGATCACGCAGATGTCCAA

GGAGACTGTCTCCAAAGACTTTCAGATTCACACGCTGCAGGAAGAAGAGATGAAGCTCAAGGCACAGGTGGCCAGATTCCAACAGGACATAGACAG GTA

CAAGCAGCAGCTGTCCCTGGCAGTGGAGAGGGGACAGAGCCTGGAGCGTGAACAGGTACAGCTAGGCCTTGACTGGCAGCGTCGCTGCGATGATATTGAA

CGAGACCAGATCCAGAAATCGGAGACTTTGATCGAAGGGCTGACCAAGGCCAGGGATCAG GTCGCTGCTAAACTCCAGGAGACAGAGAAGGCACTGCGT

CAGCAGGAGACTCTGCTGAAGGCTGTGTCACTGGAGCGAGACCAAGCTATGGAAACCCTACGTACACATGGGCTCCTTCCTGGACAGGAGGCACAG GTA

CCTCCTCAGCAGCATGAAGGAGAAATAAGGGCAGATTCTCCATCTACTGAGATCCAGAGGCTACAGGAACAGAATGCAGGTCTGCGGAACGCTGTTTCAC

AGATGAGGAGAGAGATGGAGATGCTGAGCGGTCATCTCCCCCCTGCCCAGCCAGAAGAGTGTTCAAATGCAGACCCTGATCCCAAGGCTGGAGGAGACTC

CACCCCTCCAG ATTATGTTCTGACCCTTGAAGCAGAAATGCAAAATCTAAAGCATAAACTTAAGGCATTGGAGGAACAACTACAAAGCACAGAAGAGCC

AGTGAAGACGTCCGTGGCCACTGCTGATCCACACCATGGTGTCCACAGCTCTGCAGCAGCAGCTG - UNI29841 - ACGCAGCTCTGGCAGACCAGA

CATCCACTGCATTAGCACTCAGAAAACTTGGAGACAGAGTGCACCTCTTGAACTTGCTGGTGACACAGCTCAAAAGGAAG - UNI29841 - CTGCGG

CAGAAGCCCCGGGAGCTGGTCCCTGTCCAACACGAGGTCCCCAGTGAGGTGGACCAGGTGCACCTGGAGGTTTTGGAGCTGCAGAAGCAGGTGGCTGAGT

TAAGGAAGCATCTCAAGGTGACACCCCAGGGAGAGCCTTCATCCAGGGAGCAGTTACAGAGACAG - UNI29841 - GGTGTGGCAGACCGGTACCCC

ATGGGCATGGAAGACCAGACGGAGTCCCCTACTTTCCCCCAGGAAGGGGCACAGCCTCCACAGACCATATATGTGACCCATCTGCAAAGGAAATTAAAGG

ATGCAGCTAGGAAAATACTCAGCCTCCGCCTAGAGAGGGAACAGCTCCTAGAAATGGGAAATAGACTCCGAGCTGAGCAAGGCCACGCAAAAG GGAAAC

CAACTCCTTGCCCAGGTCCTCCCACCTCTGAACCCCAGGACCCCCAGGAGGTGCCTGAGAGATCTTTGGACCGTGGCCCACCTTTGGGACAATTGCAGCC

CTACTCAACAACTCAG GACCCCAGGCACACCAAGAGAAGATGTGCTTCTGAGTATGCAGGGAAGAGTCAACCCCACTCAGCACAAGTGGGCAGCAAAAC

CAACACCCCACGAGGCCACAAGGCAGAAATGGCGTCAAGGCCTGCTCAG - UNI28697 - CTCTCACAGAAGCAGCACAGAATCCCCACAGAGACTT

GGAAGCCAGTTTATCAGAAAGAAAACAGGACCCCAAAGCTACCACAGGCTCATGAAGTCCCTGAAGAAAGTGACCACCGTACCCACAGATCGTCTTCATT

GGCCAGCAGTTCCCTCCAAGACATCTGGAGGCTGCTAGAGCTGGGATCCAGCCCTTCGGGCGTCCCCTCACAGGATAACTCTGTTGCAG - UNI12986

 - AGTGTCCAGCACCTTCAAGACCCAGCTGTTTCCAAAAGGTCAACCGGAGCCCTGTCCCCATACAAAAGGCCTTTGCTGTCAAAGGGCTAAAGATGGA

AGCTCAGCCAAAAGCCACACCCCCCAGACCCAGCAAGTCTCACCCAGCTAAACCTACAAACTGCCAGCAGCAGCGGCCCTCTAGGATCCGCAACTACAAC

CTCAAGGACTAAGTCTCAGCCTCCTGCAGGAGACTGCACAGGGGCTCCACCTTGTACGTGGGGCCTGTGGTTATACAAGTTGGGAGTGAGAATACACATG

GTATACAGGTGGGTTGTGAGCACAGGACAGCATCCCAAATGATGGCCTTTCTGATGCTAAAGAGCAATTAAAGCCTCCTCCATCTG
Translation
 - UNI19421 - MLPLCSERELNELLARKEEEWRVLQAHRAQLQEAALQAAQNRLEETQGKLQRLQEDFVYNLQVLEERDRELERYDVEFTQARQREE

AQQAEASELKIEVAKLKQDLTREARRVGELQHQHQLMLQEHRLELERVHS SDKNSELAHQREQNERLEWELERKLKELDGELALQRQ ELLLEFESKMQ

RREHEFQLRADDMSNVVLTHELK IKLLNKELQALRDAGARAAESLQKAEAEHVELERKLQERARELQDLEAVKDAR RIKGLEKKLYSAQLAKKKAEET

FRRK KHEELDRQAREKDTVLAAVKRAHAEELQTLDAKVLELQFLCETLEGQLRRAECTRAEDAKEKNALTDK KFREDAAALKAAWDAQITQMSKETVS

KDFQIHTLQEEEMKLKAQVARFQQDIDR RYKQQLSLAVERGQSLEREQVQLGLDWQRRCDDIERDQIQKSETLIEGLTKARDQ VAAKLQETEKALRQQ

ETLLKAVSLERDQAMETLRTHGLLPGQEAQ VPPQQHEGEIRADSPSTEIQRLQEQNAGLRNAVSQMRREMEMLSGHLPPAQPEECSNADPDPKAGGDST

PPD DYVLTLEAEMQNLKHKLKALEEQLQSTEEPVKTSVATADPHHGVHSSAAAAD - UNI29841 - DAALADQTSTALALRKLGDRVHLLNLLVTQ

LKRK - UNI29841 - LRQKPRELVPVQHEVPSEVDQVHLEVLELQKQVAELRKHLKVTPQGEPSSREQLQRQ - UNI29841 - GVADRYPMGME

DQTESPTFPQEGAQPPQTIYVTHLQRKLKDAARKILSLRLEREQLLEMGNRLRAEQGHAKG GKPTPCPGPPTSEPQDPQEVPERSLDRGPPLGQLQPYS

TTQ DPRHTKRRCASEYAGKSQPHSAQVGSKTNTPRGHKAEMASRPAQ - UNI28697 - LSQKQHRIPTETWKPVYQKENRTPKLPQAHEVPEESDH

RTHRSSSLASSSLQDIWRLLELGSSPSGVPSQDNSVAE - UNI12986 - ECPAPSRPSCFQKVNRSPVPIQKAFAVKGLKMEAQPKATPPRPSKSHP

AKPTNCQQQRPSRIRNYNLKD

For any suggestions or comments, please send an email to unitrap@crg.es