Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048490 (Nrip1)
Chromosomal location
Chr 16: 76287645 - 76374072 (-)
Description
nuclear receptor interacting protein 1 Gene [Source:MGI (curated);Acc:Nrip1-001]
RefSeq_dna
NM_173440 
RefSeq_peptide
NP_775616.1 
UniGene
Mm.74711 Mm.409338 Mm.455873 
MGI
MGI:1315213 
Uniprot/SWISSPROT
Q8CBD1 
Human Ortholog
ENSG00000180530 (NRIP1)
Omim not available
UniTrap UNI27121
Vector Insertion
Chr 16: 76352795 - 76373116
Public Clones IST13568A6 (tigm) IST14116E11 (tigm) IST14458E1 (tigm) IST12819H2 (tigm)
IST15001G8 (tigm) IST14140H6 (tigm) IST14209G8 (tigm)
Private Clones OST69164 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15400
Vector Insertion
Chr 16: 76330990 - 76352792
Public Clones PST8535-NL (escells) IST14785B4 (tigm) IST14204H6 (tigm) IST11617D12 (tigm)
IST14873G10 (tigm) IST14342D3 (tigm) IST14319B9 (tigm) IST14805B10 (tigm)
IST10912F12 (tigm) IST14370C7 (tigm) IST14338D3 (tigm) IST13256A7 (tigm)
Private Clones OST431093 (lexicon) OST200023 (lexicon) OST67877 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25742
Vector Insertion
Chr 16: 76295261 - 76330990
Public Clones E114B06 (ggtc) (ggtc) D095A08 (ggtc) IST15050A3 (tigm) IST12543G12 (tigm)
IST11630G4 (tigm) IST15050A4 (tigm)
Private Clones OST168339 (lexicon) OST86843 (lexicon) OST65548 (lexicon) OST33243 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054178
Sequence
AGACATTGCAGCAGAGCCCCGAACTCGGGAGGCGACGGCGACCGCGGCGCAGGCGGAGGACGAGCCGGCCCCAGCCCGCCCGAGCGCAGCGCCCGTGGCC

TCGCGCGGCCGCAGGGCACGGCTAACCTGGGAAGGAGGGAGCGACGCGGATCGGCGGCCCGGAGCCGCGGCGGCCTCG - UNI27121 - AAGGCGTG

GACTGTGAGCGGTTGCAGAGCTGTTCTCAGGACATAATCCTTTAACATTCGGGAGGAACACATCCAGGAG - UNI15400 - GTGCGCAGTTGACTGA

GGAGGCCCGGAGAATCTGAAGACTCCGATGACATCAGAGTTGCTTTTCAACAGCCTTCTCAGCTTCCTTTCCCACATAGCAGAGGCTCAGGCTGAGGCAG

ACG - UNI15400 - - UNI25742 - ATACTGACGTGCGTTTGGTGAGCAACGAAAGATGATGAAGAAAGAAAACCAGCATATTCCCTGAGACCTG

GGTGCCAGCGCTGCCGCTGTGCTAAGGAAGTTGCGAGGCTGGCCCTTGCCTAGCCACTCATCAGTGCTGTAGTCTGCACCCGAGTTTGCCCCAGCCTCTG

AGCCCCTCGTCACTGCCTGAAGATCCCCTGGTCAGAATGTTAACAGTGCATCTCTGCCCGACTGCTATGGGAGGTGATCAGGTGACGCTCACTTCCTGAC

GTCACGTGGGATCTTACTGACGAGAGGAGCTCTTTCACGTGAACGGAAGCCGAGCCCCTGTGAGCGCTTGTATTGAACATGACTCATGGAGAAGAGCTTG

GCTCTGATGTGCATCAGGATTCTATTGTCTTAACTTACCTCGAAGGGTTACTAATGCATCAGGCAGCAGGGGGATCAGGCACTGCCATTAACAAAAAGTC

TGCTGGCCACAAAGAGGAAGACCAGAACTTTAACCTCTCGGGCAGTGCGTTTCCCTCCTGTCAAAGCAATGGTCCCACTGTCAGTACCCAGACGTACCAG

GGATCTGGCATGCTGCACCTCAAAAAAGCCAGACTGCTGCAGTCTTCCGAGGACTGGAACGCGGCAAAGCGGAAGAGGCTGTCTGATTCCATCGTGAATT

TAAACGTAAAGAAGGAAGCGTTGCTGGCTGGCATGGTTGACAGTGTGCCTAAAGGCAAACAGGATAGCACATTGCTGGCCTCTTTGCTTCAGTCATTCAG

CTCTAGGCTGCAGACTGTTGCTCTGTCACAGCAGATTAGACAGAGCCTCAAGGAGCAGGGATATGCCCTCAGTCACGAGTCTTTAAAAGTGGAGAAGGAT

TTAAGGTGCTATGGCGTGGCCTCAAGTCACTTAAAAACTCTGTTGAAGAAAAGTAAAACCAAGGATCAAAAGTCAGGTCCCACCCTCCCTGACGTGACTC

CAAACCTTATCAGAGATAGCTTTGTTGAGTCATCCCATCCCGCAGTGGGACAAAGTGGGACAAAGGTCATGAGTGAGCCCTTGTCATGTGCTGCAAGATT

ACAGGCTGTTGCCAGCATGGTGGAGAAAAGGGCGAGTCCCGCTGCCTCCCCAAAGCCTAGTGTTGCCTGCAGCCAGTTGGCGCTGCTCCTGTCCAGCGAG

GCCCACCTGCAGCAGTACTCTCGGGAACATGCTCTAAAAACGCAGAACGCACATCAGGTGGCAAGCGAAAGACTTGCAGCCATGGCCAGATTGCAAGAGA

ATGGGCAGAAGGACGTGGGCAGTTCGCAGCTCTCCAAAGGGGTGTCTGGCCATCTCAACGGGCAGGCCAGAGCACTGCCGGCAAGCAAACTGGTGGCCAA

CAAGAATAACGCTGCCACCTTTCAGAGTCCAATGGGTGTTGTCCCTTCCTCCCCCAAAAACACGAGCTATAAGAACTCACTGGAAAGAAACAACCTAAAG

CAGGCTGCTAATAACAGTCTGCTTTTGCATCTCCTCAAAAGCCAGACCATACCCACGCCGATGAACGGGCACAGCCAGAACGAGAGAGCGAGCAGTTTTG

AGAGTAGCACGCCCACCACGATTGATGAGTACTCCGATAACAACCCGAGCTTTACAGATGACAGCAGTGGAGACGAAAGCTCGTACTCCAATTGCGTTCC

CATAGACCTGTCTTGCAAACACCGGATCGAAAAGCCGGAAGCTGAGCGGCCCGTTTCGCTGGAGAACCTAACCCAGTCCTTGTTAAACACGTGGGATCCC

AAGATCCCCGGCGTTGACATCAAAGAAGATCAAGATACCTCAACAAATTCCAAGCTGAATTCACACCAGAAAGTCACTCTTCTTCAGTTGCTGCTCGGCC

ATAAAAGTGAAGAAACTGTTGAAAGGAACGCCAGCCCTCAGGACATCCATAGTGATGGGACTAAGTTCAGTCCTCAGAATTACACAAGGACTTCTGTCAT

CGAAAGCCCCAGTACCAACAGGACTACCCCAGTGAGCACTCCACCACTGTATACAGCCAGCCAAGCAGAGTCTCCCATCAATCTTTCCCAGCACTCTCTG

GTCATCAAGTGGAATTCCCCGCCGTATGCCTGCAGTACTCCCGCTTCCAAGCTCACGAACACCGCGCCTAGCCACCTGATGGACCTCACGAAAGGCAAAG

AGTCCCAAGCCGAGAAACCAGCCCCGAGTGAAGGTGCACAAAATTCCGCCACGTTCAGTGCCAGTAAACTGTTACAAAATTTGGCTCAGTGCGGATTGCA

GTCTTCCGGGCCAGGGGAAGAGCAGAGACCCTGCAAACAGCTGTTAAGTGGAAACCCAGACAAACCTCTCGGTCTGATTGATAGATTAAACAGCCCTCTG

CTCTCAAATAAAACCAATGCGGCTGAAGAGAGCAAAGCCTTCAGCAGTCAGCCTGCCGGGCCTGAGCCGGGACTTCCTGGTTGTGAGATAGAAAATCTCT

TGGAAAGACGGACTGTCCTTCAGTTGCTCCTGGGAAATTCCAGCAAAGGGAAGAATGAGAAGAAAGAGAAAACCCCCGCACGAGACGAGGCTCCTCAGGA

GCATTCGGAGAGGGCTGCAAATGAACAGATACTCATGGTGAAGATTAAATCCGAGCCTTGTGACGACTTCCAGACCCACAACACAAACCTGCCCTTAAAC

CACGATGCCAAGAGCGCCCCCTTCTTAGGTGTGACTCCCGCCATCCACAGGAGCACAGCGGCCTTACCAGTGTCGGAGGACTTTAAATCCGAGCCTGCTT

CACCTCAGGATTTCTCTTTCTCAAAGAACGGGCTGTTGAGTCGCTTGCTGAGACAGAATCAAGAGAGTTACCCGGCAGATGAGCAGGACAAGAGTCACAG

AAACAGTGAGCTGCCAACCCTGGAGTCGAAGAACATCTGCATGGTCCCGAAGAAAAGGAAGCTGTATACGGAACCACTGGAGAATCCATTTAAAAAGATG

AAAAATACTGCCGTAGATACTGCCAATCATCACAGCGGCCCGGAAGTACTCTACGGGTCGTTGCTTCATCAGGAAGAGCTGAAGTTTAGCAGGAATGAGC

TCGATTATAAATACCCTGCTGGGCATAGTTCAGCCAGCGATGGTGACCACAGGAGTTGGGCCAGAGAGAGCAAAAGCTTCAATGTTCTCAAGCAGCTGCT

GCTCTCCGAGAACTGTGTGCGAGATCTGTCCCCACACAGGAGTGACTCTGTCCCCGACACGAAAAAGAAAGGACACAAAAACAACGCGCCCGGCAGCAAA

CCTGAATTCGGCATTTCTTCTTTAAATGGACTGATGTATAGTTCCCCGCAGCCTGGCAGTTGTGTGACGGATCATAGGACATTTTCATACCCGGGAATGG

TAAAGACCCCTCTGAGCCCTCCTTTCCCAGAGCACTTGGGCTGTGTGGGGTCCAGACCAGAACCTGGGCTTTTGAATGGATGTTCCGTGCCCGGTGAGAA

GGGACCCATTAAGTGGGTCATCGCAGATATGGATAAGAATGAATACGAAAAAGACTCTCCAAGACTGACCAAAACTAATCCGATCCTCTATTACATGCTC

CAGAAGGGAGGGGGCAATTCTGTTACCACACAAGAAACCCAGGACAAAGACATCTGGAGGGAGCCTGCGTCAGCCGAGAGTCTCTCACAGGTTACAGTCA

AAGAAGAGCTACTTCCCGCTGCAGAAACTAAAGCTTCTTTCTTTAATCTAAGAAGCCCGTACAATAGCCATATGGGAAATAATGCTTCTCGCCCACACAG

TACAAATGGAGAAGTGTATGGACTTCTGGGAAACGCGCTCACCATAAAAAAAGAGTCAGAATAAATGTGTACCTGCCATACCACTTTGGGTCTTTTTAAA

ATTTAGTCAGTATGAACTTGAGATCTGTATAAATAAGAGCATGATTTGAGAAAAGCATGGTATAACTGAAACTCCTTCCTTTTGAAAGTATTGGTCACTG

GTGATGTTTAAATATGCATACTAATTTTTGCTTAACATTAGATGTCATGAGGAAACAATTGAACTCGAGGTTGGTTGTTTACTATTTCTGTATGCATCAG

ATAACAACTGTGACTAGCCTACGAATGAACCTGTTTTTATAATCGTAAATAAGAGGCATACATTAAAATGCACAACTTCACCAG
Translation
 - UNI27121 -  - UNI15400 -  - UNI15400 - - UNI25742 - MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAINKKSAGHK

EEDQNFNLSGSAFPSCQSNGPTVSTQTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQ

TVALSQQIRQSLKEQGYALSHESLKVEKDLRCYGVASSHLKTLLKKSKTKDQKSGPTLPDVTPNLIRDSFVESSHPAVGQSGTKVMSEPLSCAARLQAVA

SMVEKRASPAASPKPSVACSQLALLLSSEAHLQQYSREHALKTQNAHQVASERLAAMARLQENGQKDVGSSQLSKGVSGHLNGQARALPASKLVANKNNA

ATFQSPMGVVPSSPKNTSYKNSLERNNLKQAANNSLLLHLLKSQTIPTPMNGHSQNERASSFESSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPIDLS

CKHRIEKPEAERPVSLENLTQSLLNTWDPKIPGVDIKEDQDTSTNSKLNSHQKVTLLQLLLGHKSEETVERNASPQDIHSDGTKFSPQNYTRTSVIESPS

TNRTTPVSTPPLYTASQAESPINLSQHSLVIKWNSPPYACSTPASKLTNTAPSHLMDLTKGKESQAEKPAPSEGAQNSATFSASKLLQNLAQCGLQSSGP

GEEQRPCKQLLSGNPDKPLGLIDRLNSPLLSNKTNAAEESKAFSSQPAGPEPGLPGCEIENLLERRTVLQLLLGNSSKGKNEKKEKTPARDEAPQEHSER

AANEQILMVKIKSEPCDDFQTHNTNLPLNHDAKSAPFLGVTPAIHRSTAALPVSEDFKSEPASPQDFSFSKNGLLSRLLRQNQESYPADEQDKSHRNSEL

PTLESKNICMVPKKRKLYTEPLENPFKKMKNTAVDTANHHSGPEVLYGSLLHQEELKFSRNELDYKYPAGHSSASDGDHRSWARESKSFNVLKQLLLSEN

CVRDLSPHRSDSVPDTKKKGHKNNAPGSKPEFGISSLNGLMYSSPQPGSCVTDHRTFSYPGMVKTPLSPPFPEHLGCVGSRPEPGLLNGCSVPGEKGPIK

WVIADMDKNEYEKDSPRLTKTNPILYYMLQKGGGNSVTTQETQDKDIWREPASAESLSQVTVKEELLPAAETKASFFNLRSPYNSHMGNNASRPHSTNGE

VYGLLGNALTIKKESE
Transcript ENSMUST00000121927
Sequence
GAGAAACCAGGTTCCTGGGTCCTGCGTCCGTCTAGGGAGCTAGCTGTGCACTCCTCAG - UNI15400 - - UNI27121 - GCGTGGACTGTGAGC

GGTTGCAGAGCTGTTCTCAGGACATAATCCTTTAACATTCGGGAGGAACACATCCAGGAG - UNI15400 - GTGCGCAGTTGACTGAGGAGGCCCGG

AGAATCTGAAGACTCCGATGACATCAGAGTTGCTTTTCAACAGCCTTCTCAGCTTCCTTTCCCACATAGCAGAGGCTCAGGCTGAGGCAGACG - UNI1

5400 - - UNI25742 - ATACTGACGTGCGTTTGGTGAGCAACGAAAGATGATGAAGAAAGAAAACCAGCATATTCCCTGAGACCTGGGTGCCAGCG

CTGCCGCTGTGCTAAGGAAGTTGCGAGGCTGGCCCTTGCCTAGCCACTCATCAGTGCTGTAGTCTGCACCCGAGTTTGCCCCAGCCTCTGAGCCCCTCGT

CACTGCCTGAAGATCCCCTGGTCAGAATGTTAACAGTGCATCTCTGCCCGACTGCTATGGGAGGTGATCAGGTGACGCTCACTTCCTGACGTCACGTGGG

ATCTTACTGACGAGAGGAGCTCTTTCACGTGAACGGAAGCCGAGCCCCTGTGAGCGCTTGTATTGAACATGACTCATGGAGAAGAGCTTGGCTCTGATGT

GCATCAGGATTCTATTGTCTTAACTTACCTCGAAGGGTTACTAATGCATCAGGCAGCAGGGGGATCAGGCACTGCCATTAACAAAAAGTCTGCTGGCCAC

AAAGAGGAAGACCAGAACTTTAACCTCTCGGGCAGTGCGTTTCCCTCCTGTCAAAGCAATGGTCCCACTGTCAGTACCCAGACGTACCAGGGATCTGGCA

TGCTGCACCTCAAAAAAGCCAGACTGCTGCAGTCTTCCGAGGACTGGAACGCGGCAAAGCGGAAGAGGCTGTCTGATTCCATCGTGAATTTAAACGTAAA

GAAGGAAGCGTTGCTGGCTGGCATGGTTGACAGTGTGCCTAAAGGCAAACAGGATAGCACATTGCTGGCCTCTTTGCTTCAGTCATTCAGCTCTAGGCTG

CAGACTGTTGCTCTGTCACAGCAGATTAGACAGAGCCTCAAGGAGCAGGGATATGCCCTCAGTCACGAGTCTTTAAAAGTGGAGAAGGATTTAAGGTGCT

ATGGCGTGGCCTCAAGTCACTTAAAAACTCTGTTGAAGAAAAGTAAAACCAAGGATCAAAAGTCAGGTCCCACCCTCCCTGACGTGACTCCAAACCTTAT

CAGAGATAGCTTTGTTGAGTCATCCCATCCCGCAGTGGGACAAAGTGGGACAAAGGTCATGAGTGAGCCCTTGTCATGTGCTGCAAGATTACAGGCTGTT

GCCAGCATGGTGGAGAAAAGGGCGAGTCCCGCTGCCTCCCCAAAGCCTAGTGTTGCCTGCAGCCAGTTGGCGCTGCTCCTGTCCAGCGAGGCCCACCTGC

AGCAGTACTCTCGGGAACATGCTCTAAAAACGCAGAACGCACATCAGGTGGCAAGCGAAAGACTTGCAGCCATGGCCAGATTGCAAGAGAATGGGCAGAA

GGACGTGGGCAGTTCGCAGCTCTCCAAAGGGGTGTCTGGCCATCTCAACGGGCAGGCCAGAGCACTGCCGGCAAGCAAACTGGTGGCCAACAAGAATAAC

GCTGCCACCTTTCAGAGTCCAATGGGTGTTGTCCCTTCCTCCCCCAAAAACACGAGCTATAAGAACTCACTGGAAAGAAACAACCTAAAGCAGGCTGCTA

ATAACAGTCTGCTTTTGCATCTCCTCAAAAGCCAGACCATACCCACGCCGATGAACGGGCACAGCCAGAACGAGAGAGCGAGCAGTTTTGAGAGTAGCAC

GCCCACCACGATTGATGAGTACTCCGATAACAACCCGAGCTTTACAGATGACAGCAGTGGAGACGAAAGCTCGTACTCCAATTGCGTTCCCATAGACCTG

TCTTGCAAACACCGGATCGAAAAGCCGGAAGCTGAGCGGCCCGTTTCGCTGGAGAACCTAACCCAGTCCTTGTTAAACACGTGGGATCCCAAGATCCCCG

GCGTTGACATCAAAGAAGATCAAGATACCTCAACAAATTCCAAGCTGAATTCACACCAGAAAGTCACTCTTCTTCAGTTGCTGCTCGGCCATAAAAGTGA

AGAAACTGTTGAAAGGAACGCCAGCCCTCAGGACATCCATAGTGATGGGACTAAGTTCAGTCCTCAGAATTACACAAGGACTTCTGTCATCGAAAGCCCC

AGTACCAACAGGACTACCCCAGTGAGCACTCCACCACTGTATACAGCCAGCCAAGCAGAGTCTCCCATCAATCTTTCCCAGCACTCTCTGGTCATCAAGT

GGAATTCCCCGCCGTATGCCTGCAGTACTCCCGCTTCCAAGCTCACGAACACCGCGCCTAGCCACCTGATGGACCTCACGAAAGGCAAAGAGTCCCAAGC

CGAGAAACCAGCCCCGAGTGAAGGTGCACAAAATTCCGCCACGTTCAGTGCCAGTAAACTGTTACAAAATTTGGCTCAGTGCGGATTGCAGTCTTCCGGG

CCAGGGGAAGAGCAGAGACCCTGCAAACAGCTGTTAAGTGGAAACCCAGACAAACCTCTCGGTCTGATTGATAGATTAAACAGCCCTCTGCTCTCAAATA

AAACCAATGCGGCTGAAGAGAGCAAAGCCTTCAGCAGTCAGCCTGCCGGGCCTGAGCCGGGACTTCCTGGTTGTGAGATAGAAAATCTCTTGGAAAGACG

GACTGTCCTTCAGTTGCTCCTGGGAAATTCCAGCAAAGGGAAGAATGAGAAGAAAGAGAAAACCCCCGCACGAGACGAGGCTCCTCAGGAGCATTCGGAG

AGGGCTGCAAATGAACAGATACTCATGGTGAAGATTAAATCCGAGCCTTGTGACGACTTCCAGACCCACAACACAAACCTGCCCTTAAACCACGATGCCA

AGAGCGCCCCCTTCTTAGGTGTGACTCCCGCCATCCACAGGAGCACAGCGGCCTTACCAGTGTCGGAGGACTTTAAATCCGAGCCTGCTTCACCTCAGGA

TTTCTCTTTCTCAAAGAACGGGCTGTTGAGTCGCTTGCTGAGACAGAATCAAGAGAGTTACCCGGCAGATGAGCAGGACAAGAGTCACAGAAACAGTGAG

CTGCCAACCCTGGAGTCGAAGAACATCTGCATGGTCCCGAAGAAAAGGAAGCTGTATACGGAACCACTGGAGAATCCATTTAAAAAGATGAAAAATACTG

CCGTAGATACTGCCAATCATCACAGCGGCCCGGAAGTACTCTACGGGTCGTTGCTTCATCAGGAAGAGCTGAAGTTTAGCAGGAATGAGCTCGATTATAA

ATACCCTGCTGGGCATAGTTCAGCCAGCGATGGTGACCACAGGAGTTGGGCCAGAGAGAGCAAAAGCTTCAATGTTCTCAAGCAGCTGCTGCTCTCCGAG

AACTGTGTGCGAGATCTGTCCCCACACAGGAGTGACTCTGTCCCCGACACGAAAAAGAAAGGACACAAAAACAACGCGCCCGGCAGCAAACCTGAATTCG

GCATTTCTTCTTTAAATGGACTGATGTATAGTTCCCCGCAGCCTGGCAGTTGTGTGACGGATCATAGGACATTTTCATACCCGGGAATGGTAAAGACCCC

TCTGAGCCCTCCTTTCCCAGAGCACTTGGGCTGTGTGGGGTCCAGACCAGAACCTGGGCTTTTGAATGGATGTTCCGTGCCCGGTGAGAAGGGACCCATT

AAGTGGGTCATCGCAGATATGGATAAGAATGAATACGAAAAAGACTCTCCAAGACTGACCAAAACTAATCCGATCCTCTATTACATGCTCCAGAAGGGAG

GGGGCAATTCTGTTACCACACAAGAAACCCAGGACAAAGACATCTGGAGGGAGCCTGCGTCAGCCGAGAGTCTCTCACAGGTTACAGTCAAAGAAGAGCT

ACTTCCCGCTGCAGAAACTAAAGCTTCTTTCTTTAATCTAAGAAGCCCGTACAATAGCCATATGGGAAATAATGCTTCTCGCCCACACAGTACAAATGGA

GAAGTGTATGGACTTCTGGGAAACGCGCTCACCATAAAAAAAGAGTCAGAATAAATGTGTACCTGCCATACCACTTTGGGTCTTTTTAAAATTTAGTCAG

TATGAACTTGAGATCTGTATAAATAAGAGCATGATTTGAGAAAAGCATGGTATAACTGAAACTCCTTCCTTTTGAAAGTATTGGTCACTGGTGATGTTTA

AATATGCATACTAATTTTTGCTTAACATTAGATGTCATGAGGAAACAATTGAACTCGAGGTTGGTTGTTTACTATTTCTGTATGCATCAGATAACAACTG

TGACTAGCCTACGAATGAACCTGTTTTTATAATCGTAAATAAGAGGCATACATTAAAATGCACAACTTCACCAGTAGTGGATTGATGCAACTTGCTGTCT

TTATTAGGGTTGTTCATTTCCCATCTCAGAAGCCAGCCTACATAACGTGTTTGTAACATCCAAACTGTTAGCTATTTGGAAGATAACCAAATTAGGAAAA

AAAAAAAAACCCAGAAGCCTTGTGCTGATTCACACCTCATCAGTCTAAAAGTAAGAAAAAGCAATGCTTACATTTTTTCACTTTTGCTAAACAAAATTCT

TTTTAACTCTTGGAAGGGGTTTTGCGGTTCCCAATGAGTCTGCCCCACCCCAGACCTTTTCAATATATATATTTCTTTAAACCTTTTACTATTTAGTAAC

AATTGATTACAATAGAGGGGAGTTTAATAGATCCTTAAAAATAAAAGGCAGATTTCCATTTTTTTATATTTTGACTACTTTACTAAATTAATACTCCTCC

TTTTTCAAAATTAGAGAAGGAAATCTTCACTCACCTTCAGGCTGTTTCCTGGACAATTGACTACTTAGAAATCGTTTTTAACAAAAGCAGAAATGGGTTT

TCTTTGGATGGTTTTTACCGTCTCTTTTGAAAGTTGATCCTCACCACTCCTGTGGGACCCGTGACTTTACAACCAGGATTTCTTAATTCTGGACAGAGAC

ACTGCATTCATCTGACTATCACATGAGTCTCTGGAACAGTTATTTAAATGCAGACTCCTAGGCAGCATCTCAGGTCTACAGAACACCGTCTCCAAGTGGA

CCCGGGCGTCCTCCTTCCGCCTGTATCCTGACATGTTCTGTATGTGCTTCTTCCGCACACTGATGTTTGAAAACTGTGGCTTAGGACTTTTCCAGAACAT

GAGACTTTAAAGTAACTATCTGATGCCTATACTTTTCCCCCAATACAGTCACATATCCACTCAAAATTTGCAATATCATAGTTCCAATCTTACTATTATA

TCTTTGGAAATCGGGTTCGGAATACTTTTTATGACAAAAAAAAAAAATTGGGTAGAGGGGACAACTTTCCTATCTGGGTCAACATCTCAGGAAAATCTGT

GATTATTTATTTGCTCTAATTAGTAAGATTAACTTAATTAGCCTTAGGGGTGGAATAACAGGGCCACTTAGCAAACTCAGGTGATCCCAGGACGGTTGGG

AAACTTCTTGAATACATCCTTACCTGCTAGTCAAACTGTCCTCTGCACAGCAGTGTTTATGGAGTTAACAGATTCAACCCAAGAAAGACATCAAACTCAG

ATTACCTGAAACCAAATCAAAGGGCACTTATCAATCCATGACAGGACCTGCACAGTCACTTCACGGATCAATTCATTTTAAACAGGCATTAAAAGTAAAT

ACTGACATTGTCTTGAAAGAACTTAATATATAATTGAGCCACGTGGAATTTCAGTCTTGAAACAGGTTGGTTTTTAAGTTCATTTGTTTATAGCCCACAG

TTCCTCCTCCAGGCAATATTTTTTGTTTTTCAGTTTTGAGCCAGGTTAACAACTGACTTATCAAAAACTTACTGTGTACTCAGCAGTTAAGTAGGAAGAA

GTTTATTTGGAATTGTTATACATACTTGAAGTTGTTTCTAAGATTTTTTTTATATATATTACAAATGGACATTATTTCTTAATTACCTAAAATTCTAAAT

GGTTATTTTTTCTCAAGATGATTTGTAAATAGTTAATGGGTATGTTATATGGTAACCAGAGTGTATGTTATGCAACATCAGAGAAAGGAGAACGTGTATG

CTTATTCTGCTATGAAAAATTCCACTGGCCAGTGAGGTACTTTACTCCATGTTTATACTGTGACAATCTCATTGTCTACACTATATAAATAAGCTTTACA

CTTAGTCATTTTTCTTGGTCATGGTGAAAGGGCTGGAGCCTTAGAAATATATTGTAGGATGCTGGAGTTCGTCCTCTGTTCACGGCGCAGTAGTCTTCTT

ACAATGGAACAGCACTTAGGTCAGGGAAACGTCCAGAGCCAGCATCGCTTCGCTTTGTTTTGTTTTGTTTTTGTTGGAATGAGAATATGTAAGACAAAAA

TAAACATGCCTATGAAGGATGCTGTTCTGACTTTCTAGAGAATAACCCCCCCCCCATGTTTTGTTTAGAGAAATCTTAAAGAAGAGAAAGGGCATAATAC

ATCCACAAATTCACTTTGCATATGTAGATTCAAATATGCACATACACATTTTCGAGGACTATTTTCGATATCTGGGCAGTTTCTTCCTAATAAAGTCATT

TGTGAATGGGTACTACAGCTCTCATTGACATCAGTAAGGTAGCATTACCTGTTTATTCTCTGCTACATCTTACAGAAGAATAAACTGGTGAGAGTATATA

TTTTCTATATATATACATATATATATATATAAATGTGTATATATATATATTGACTTGTTACATGAAGATGTTAAAATTGGTTTTTAAAGGTAATGTAAAT

AATGATTTCCTTAATGAAAAAATACATATTTTGTATTGTTCTAATGCAACAGAAAAACCTTTTAATTTCTTTGGTTCCTGTATATTCCATGTATTAAGTG

TAAATATAATCAGACAGGTTTAAAAAAATGTGCATGTATGTATACAGTTGCAAGTCTGGACAAATGTATAAAATAAACCTTTTATTTAAGTCTGCGTACC

TGCTGCATGACGACAAGTGCATGGGGGACCCTGTGCATCTGTGCATTCGACAGAAACCGTCTTAAGTCAGGGCAGATGGTCATCCAACACGACAGTATTC

CATTTCCGGACATGACCTCTGTGGCTTATGCTTTGTGAGAAAATGTGCTTCGAATTCAAGGGTCTTAATTTTTTTTTCTTTTTAATCAACCACTTTCAAC

ATTAAAGAACTCACAGAGCAACTTCACAACTCTTCAAATCCCATTGGAAACATAACCAGGAATAGTCCAGTGTTCCTAAATGCTGGAATATAGGCACATT

ACCGTTCATGGTAAGAATCTTGGGTTTACAGCCAGTTTTGATGCAGCCTGCTTAGTGATATTAATTTGCCATTTTTATTATTAAATTTGATTTCTTTATG

TGATGTAATGAATTGTACATACCGCAGTGTGAATTTTTTTTTAAATCTTTTAGTGTTTACTTCCTGCAGTGAATTTGAATAAATGAGAAATGCATTGTCT

CTAACTTGAAATGGCTTCTTTTTTGTGGGCTTTCTCTGGTTTTTAGGTTTTCCATTAATGTTAAAGTCCAAGGTCATAGAGAGAAAAAGGAAAAAAGCAA

TAGACATGTATTTTGTCTGTCTCAGAAAAATGAAGGGGGAAAAAAATAAGCAACTGATTAGCAAGTTAGTATATTTAGAAACCTGTAATTAAAGTATAGC

TCAAAATGACAGCTGGCCTGTGGTCTGTCTTCCATTTCTCAGTATGTAACTGAATGACCACTACATGGTTTTGTTTTTTTTTTTTAAACTGAAGTTTGTA

CAGTGTTCCAAAATAAAGTTAATTAGATACATATAC
Translation
 - UNI15400 - - UNI27121 -  - UNI15400 -  - UNI15400 - - UNI25742 - MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGG

SGTAINKKSAGHKEEDQNFNLSGSAFPSCQSNGPTVSTQTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNVKKEALLAGMVDSVPKGKQDSTL

LASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHESLKVEKDLRCYGVASSHLKTLLKKSKTKDQKSGPTLPDVTPNLIRDSFVESSHPAVGQSGTKVMS

EPLSCAARLQAVASMVEKRASPAASPKPSVACSQLALLLSSEAHLQQYSREHALKTQNAHQVASERLAAMARLQENGQKDVGSSQLSKGVSGHLNGQARA

LPASKLVANKNNAATFQSPMGVVPSSPKNTSYKNSLERNNLKQAANNSLLLHLLKSQTIPTPMNGHSQNERASSFESSTPTTIDEYSDNNPSFTDDSSGD

ESSYSNCVPIDLSCKHRIEKPEAERPVSLENLTQSLLNTWDPKIPGVDIKEDQDTSTNSKLNSHQKVTLLQLLLGHKSEETVERNASPQDIHSDGTKFSP

QNYTRTSVIESPSTNRTTPVSTPPLYTASQAESPINLSQHSLVIKWNSPPYACSTPASKLTNTAPSHLMDLTKGKESQAEKPAPSEGAQNSATFSASKLL

QNLAQCGLQSSGPGEEQRPCKQLLSGNPDKPLGLIDRLNSPLLSNKTNAAEESKAFSSQPAGPEPGLPGCEIENLLERRTVLQLLLGNSSKGKNEKKEKT

PARDEAPQEHSERAANEQILMVKIKSEPCDDFQTHNTNLPLNHDAKSAPFLGVTPAIHRSTAALPVSEDFKSEPASPQDFSFSKNGLLSRLLRQNQESYP

ADEQDKSHRNSELPTLESKNICMVPKKRKLYTEPLENPFKKMKNTAVDTANHHSGPEVLYGSLLHQEELKFSRNELDYKYPAGHSSASDGDHRSWARESK

SFNVLKQLLLSENCVRDLSPHRSDSVPDTKKKGHKNNAPGSKPEFGISSLNGLMYSSPQPGSCVTDHRTFSYPGMVKTPLSPPFPEHLGCVGSRPEPGLL

NGCSVPGEKGPIKWVIADMDKNEYEKDSPRLTKTNPILYYMLQKGGGNSVTTQETQDKDIWREPASAESLSQVTVKEELLPAAETKASFFNLRSPYNSHM

GNNASRPHSTNGEVYGLLGNALTIKKESE

For any suggestions or comments, please send an email to unitrap@crg.es