Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048502 (AC175032.1-202)
Chromosomal location
Chr 14: 26802491 - 26808880 (+)
Description
double homeobox B-like  [Source:RefSeq peptide;Acc:NP_899245]
RefSeq_dna
NM_183389 
RefSeq_peptide
NP_899245.1 
UniGene
Mm.428840 Mm.429131 
Uniprot/SPTREMBL
Q3V4B9 Q7TNE6 
Human Ortholog
ENSG00000214325 (AC025287.8)
Omim not available
UniTrap UNI28240
Vector Insertion
Chr 14: 26803787 - 26806250
Public Clones not available
Private Clones OST36267 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049793
Sequence
ATTGCTGTGCGCCCCAGGTCAGGCAGAATATCATGGTAGTGAGTCTGAGCCTCAGAGAGCAAGACAGAGACAGGGAGAGAGAGACAGAAAGGGAGAGAGA

GAGAGACAGAGAGACAGAGAGAGAGAGAGAGAGCAGAGAGCACTGTCCTTTAAAGCCACATAGCCAACAACTCATCTGCTCCATCTGACTCCCCACAGTC

ACAGTCCATCATCTGTCAAGAGTCTTTTAAAACTTCAGTCCATCAAGGAGTTAAACCAGTGATTAGCTCAACTCTCTCATGATATAATCTTCTCTGGAAA

CCACCCCAGACACACCCAGAGGCGGGTTTCACTAATCTCCCAGGAACCTCTTAATCCAATCAAGTTGACTATCAAGATTTGCCACAGTGCTGCATATTTA

ATGAAAGGATTAAACAACCAACAGGTATTTAAGAAATGGGTGGGCCACTCTGGGCTCTACTACATCCTGTGTCTCTGTGACAGCTCTCTTGGGCCTCTTG

GGATCCAGATGGCTGCAGCATGGAGCTGAGCTGCAGTACTG GCCTACTGGAAAAAGAAGCCCGGAGAAGGAGAATCATTCTAACCCAGAGTCAAAAGGA

CACTCTTCGTGTGTGGTTTGAAAAGAATCCCAATCCTGATCTAGCTACCAGAGGACATCTGGCTAAGGAACTCGGCATCTCTGAGTCTCAAATTATG - 

UNI28240 - ACTTGGTTTCAAAAGCATAGAAAAATACGGAAGCAAGCAGAGTTTGCATGCTGTTCTGAAGAAAGCCAAGAGCAGGAGCAGGATAAACC

TAGAG TTAAAGAAGCTAGAAGGAGCAGAACGCACTTCACAAAGTTCCAGACTGATATTCTAATTGAAGCTTTTGAGAAGAATCGGTTCCCTGGGATTGT

TACCAGGGAAAAACTGGCTCAACAAACAGGCATCCCAGAATCCAGGATTCAT ATATGGTTTCAGAACCGGAGAGCACGGCACCCAGACCCAGGACAGAA

CACTCAGAAAACTCCTCATCCACCCCAGAGCAGTCAGGGCCCTACCCAGAAAACTGTGGGTAAACTCGCTCCTTCCAAAACTCTCACCAGCAGCGCTTCA

GTTATACTGCCTCTTTCTCCACCCCACACTCCAAATGGGCCTTTGGATCTCTCTAAGGGCCGTCAGAAGCAGTTACCAGGGACCACACTACTTCAGTCCT

CCCAGGTTGTACAGCAAAGGAGTGATGATCAAAATCCCAATAAAGGTCACTTATCACCGACAACAACTCCAGGAGAGCAGGGCTTCCATTCTCAGCCTCC

TTTACAGCTCCTAACCCAAAACAGAGGGCATAATCCCAGAGAGAGCGGTGGTTTGGCGGTACCGCGCTTAGAAGATTGTACTCAGGTCCCAGCTGTCAAT

CAACACTTCCGGAAACTAGACCAAAATGATTCCTCCTTTCTCCAACACTGGGACGAGTGGTTCGGATCCATGCTTGCTGAATGGATGCCTGACAAAGAAT

ACTGGTCTGAGAAAGCTGAGCTGCATCCGTGGCAGGTGCAGCTGCGGCAGCTTGCCAGCGTGTCTCCTCAAGCACACCAAACTCCGTAG
Translation
MELSCSTG GLLEKEARRRRIILTQSQKDTLRVWFEKNPNPDLATRGHLAKELGISESQIM - UNI28240 - TWFQKHRKIRKQAEFACCSEESQEQ

EQDKPRV VKEARRSRTHFTKFQTDILIEAFEKNRFPGIVTREKLAQQTGIPESRIH IWFQNRRARHPDPGQNTQKTPHPPQSSQGPTQKTVGKLAPSK

TLTSSASVILPLSPPHTPNGPLDLSKGRQKQLPGTTLLQSSQVVQQRSDDQNPNKGHLSPTTTPGEQGFHSQPPLQLLTQNRGHNPRESGGLAVPRLEDC

TQVPAVNQHFRKLDQNDSSFLQHWDEWFGSMLAEWMPDKEYWSEKAELHPWQVQLRQLASVSPQAHQTP

For any suggestions or comments, please send an email to unitrap@crg.es