Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048728 (Zfp454)
Chromosomal location
Chr 11: 50686222 - 50701153 (-)
Description
zinc finger protein 454 Gene [Source:MGI (curated);Acc:Zfp454-003]
RefSeq_dna
NM_172794 
RefSeq_peptide
NP_766382.2 
UniGene
Mm.74335 
MGI
MGI:2679253 
Uniprot/SPTREMBL
Q5NCH7 Q5NCH5 Q80Y34 Q8BIK0 
Human Ortholog
ENSG00000178187 (ZNF454)
Omim not available
UniTrap UNI33405
Vector Insertion
Chr 11: 50686226 - 50691434
Public Clones IST11154C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109131
Sequence
GACTAGGCGCAGGCGCGCTTTATCGCTTTTTGCTCCTGGTCTCCCTCTGAGAAAAGGAGTCCAAAAATCTAAGCGCTGCAGCAGAGAGATTTGTGGGAAT

TAGGCTTCCCGGCTCCTGGACAAACGCGCAGGCGCGGCTCCGCGTCAAGCAGCAGGCTCCAGCTCATTGTGTCCTGACTACTCTGTCGAGGCTATGCTCT

GCAGTGGACAAGCTTCTAAGGGAAGCCCCACGGTGATCTGCAGTGTCCAGAGACTGAAG GAGTGCAGATGCTTCTAGCCAGAGAACCCCAGCAATTGTA

AAGCTCCTCCCCTGCCTCCTTCCTACTCAATGCTCCTCAGCTCACCAGAGAAAAGGAATGGCTGTCAGCCAGCTCCCGGCCCTGGTCCAG - UNI3340

5 - GGGAAATTACAGTGGCCATGAGTAAGAAATTCCTCAAGGCAGATATCCCTGAGAAAGAGTCGGATCAATGGATAGCAAAGGAAAGAGCATGTGCTA

ACTTGTTCAATTGGCAGTGCCAGGAAGGTCAGGAGGTGAAGTTGCAGCAAGTGGTCCTCACCCAGCAGAACACTCCATCAAAACTGAGTGAGCAGAGAGT

CAGAGCAGAGAGCTCATCACCCATCCAAAGTCAGAGATCTCAAGCAAGCAAAACGGCTTTTGAATGCAGCGAATGCGGGAAAGCCTTCTCTAAGAGTTCC

ACCCTTAAGAAGCATCAGAAACTTCATACCGAAAAACTCAACCCAAGTCAGAAATCACCAATGAAAGAGAAGCGATACAAGTGCCGAGAATGTGGGAAAG

CCTTCCACCAGAGTACACACCTCATCCATCACCAAAGAGTCCACACTGGCGAGAAACCATACCAGTGCAAGGACTGTGGCAAGGCCTTCTCAGTGAGCTC

TTCCCTTTCCTACCACCAGAAAATCCATACCGGAGAAAAGCCCTTTGAATGTAATGTTTGTGGAAAGGCCTTTATCCGGAACATACATCTTTCCCACCAT

CATAGAATGCACACTGGAGAGAAACCTTTCCAATGCAACCTTTGTGACAAAGCTTTCGTTTGCAGAGCACATCTTACCAAACACCAGCACATTCACAGTG

GCAAGAAGCCCTATAAATGTAATGAGTGTGGGAAAGCCTTCAATCAGAGTACAAGTTTTCTGCAGCATCAGAGGATCCACACTGGAGAGAAACCCTTTGA

ATGCAACGAGTGTGGCAAGGCCTTCAGGGTGAACTCTTCCCTTACTGAACACCAGAGAATCCACACTGGGGAGAAACCATATCAATGTATCGAATGTGGC

AAAGCTTTCAGGGATAACTCATCCTTTGCACGCCATCGGAAAATTCACACTGGAGAGAAACCTTACAGATGTGGCTTGTGTGAGAAGGCTTTCAGGGACC

AGTCAGCCCTAGCACAGCATCAGAGAACTCACACTGGGGAAAAGCCTTACACGTGTAACATATGTGAGAAAGCCTTCAGTGACCATTCGGCCCTTACCCA

ACATAAGAGAATTCACACGAGAGAAAAACCGTACAAATGTAAAACCTGTGGGAAAGCTTTTATCCGAAGCACACACCTCATTCAACACCAGAGGATTCAC

ACGGGAGAGAAACCTTACAAATGTAACACATGCGGGAAAGCCTTCAACCAGACTGCAAACCTCGCTCAGCACCAGAGGCATCACACTGGAGGAAAGTGAT

AGAAAGGCAGTTAATAGGTGCTGAGGGGATGATGTCATTAATTATTGAATAGAAGAGAGTACATAATCACACTGAAGTCTTTTATCATCATGGTTGGATT

TACTCGGAGCCAGGTTGCCTAATGCTAAGGGTCTTGAGAATCTTATGAATGGTGAACACACCTTACTCTTCAGTCTGCCACAGTTGGATAGTAGTGCCTT

TTTATTGGCCTGAATTACTATTAGAACCAAAATGAAAATTCATTAAAAGCATAAATGTCAGTTTATCAAATT
Translation
  - UNI33405 - MSKKFLKADIPEKESDQWIAKERACANLFNWQCQEGQEVKLQQVVLTQQNTPSKLSEQRVRAESSSPIQSQRSQASKTAFECSEC

GKAFSKSSTLKKHQKLHTEKLNPSQKSPMKEKRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKDCGKAFSVSSSLSYHQKIHTGEKPFECNVCGKAFI

RNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHTGEK

PYQCIECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKTCGKAFIRSTH

LIQHQRIHTGEKPYKCNTCGKAFNQTANLAQHQRHHTGGK
Transcript ENSMUST00000078418
Sequence
CAAGCTTCTAAGGGAAGCCCCACGGTGATCTGCAGTGTCCAGAGACTGAAGGTCAGGTCTGGGAGTTGAGAACAGAGG GAGTGCAGATGCTTCTAGCCA

GAGAACCCCAGCAATTGTAAAGCTCCTCCCCTGCCTCCTTCCTACTCAATGCTCCTCAGCTCACCAGAGAAAAGGAATGGCTGTCAGCCAGCTCCCGGCC

CTGGTCCAG GACTTGGTGACCTTCAAGGATGTGGCCGTGCTTTTCACCCAGGAGGAGTGGGGTCAGCTGAGCTCTGCCCAGAGGGCCTTGTATCAGGAT

GTGATGCTAGAGAACTACAGTAACCTGGTCTCACTGG CAGGTCTCTTAGGATCCCAACCAGATATGTTCTTTCCCCTGGAGGAAGTGGAAGAATGTGTG

TCAGAGGAGGCTCCTGAGGGCTTTGTTCTGG ATGCCGCAGATGAACCTCACTTGGGTCCTCGATCTGCGTGTGAAGCTCAGGTTCCGGTTACAG - UN

I33405 - AAAACAGAGGAGTAGGATATCACAGCAGGCAAGGTACATCGAAGTATCAG
Translation
 MAVSQLPALVQ DLVTFKDVAVLFTQEEWGQLSSAQRALYQDVMLENYSNLVSLA AGLLGSQPDMFFPLEEVEECVSEEAPEGFVLD DAADEPHLGP

RSACEAQVPVTE - UNI33405 - ENRGVGYHSRQGTSKYQ
Transcript ENSMUST00000050595
Sequence
CAAGCTTCTAAGGGAAGCCCCACGGTGATCTGCAGTGTCCAGAGACTGAAGGTCAGGTCTGGGAGTTGAGAACAGAGG GAGTGCAGATGCTTCTAGCCA

GAGAACCCCAGCAATTGTAAAGCTCCTCCCCTGCCTCCTTCCTACTCAATGCTCCTCAGCTCACCAGAGAAAAGGAATGGCTGTCAGCCAGCTCCCGGCC

CTGGTCCAG GACTTGGTGACCTTCAAGGATGTGGCCGTGCTTTTCACCCAGGAGGAGTGGGGTCAGCTGAGCTCTGCCCAGAGGGCCTTGTATCAGGAT

GTGATGCTAGAGAACTACAGTAACCTGGTCTCACTGG CAGGTCTCTTAGGATCCCAACCAGATATGTTCTTTCCCCTGGAGGAAGTGGAAGAATGTGTG

TCAGAGGAGGCTCCTGAGGGCTTTGTTCTGG ATGCCGCAGATGAACCTCACTTGGGTCCTCGATCTGCGTGTGAAGCTCAGGTTCCGGTTACAG - UN

I33405 - GGGAAATTACAGTGGCCATGAGTAAGAAATTCCTCAAGGCAGATATCCCTGAGAAAGAGTCGGATCAATGGATAGCAAAGGAAAGAGCATG

TGCTAACTTGTTCAATTGGCAGTGCCAGGAAGGTCAGGAGGTGAAGTTGCAGCAAGTGGTCCTCACCCAGCAGAACACTCCATCAAAACTGAGTGAGCAG

AGAGTCAGAGCAGAGAGCTCATCACCCATCCAAAGTCAGAGATCTCAAGCAAGCAAAACGGCTTTTGAATGCAGCGAATGCGGGAAAGCCTTCTCTAAGA

GTTCCACCCTTAAGAAGCATCAGAAACTTCATACCGAAAAACTCAACCCAAGTCAGAAATCACCAATGAAAGAGAAGCGATACAAGTGCCGAGAATGTGG

GAAAGCCTTCCACCAGAGTACACACCTCATCCATCACCAAAGAGTCCACACTGGCGAGAAACCATACCAGTGCAAGGACTGTGGCAAGGCCTTCTCAGTG

AGCTCTTCCCTTTCCTACCACCAGAAAATCCATACCGGAGAAAAGCCCTTTGAATGTAATGTTTGTGGAAAGGCCTTTATCCGGAACATACATCTTTCCC

ACCATCATAGAATGCACACTGGAGAGAAACCTTTCCAATGCAACCTTTGTGACAAAGCTTTCGTTTGCAGAGCACATCTTACCAAACACCAGCACATTCA

CAGTGGCAAGAAGCCCTATAAATGTAATGAGTGTGGGAAAGCCTTCAATCAGAGTACAAGTTTTCTGCAGCATCAGAGGATCCACACTGGAGAGAAACCC

TTTGAATGCAACGAGTGTGGCAAGGCCTTCAGGGTGAACTCTTCCCTTACTGAACACCAGAGAATCCACACTGGGGAGAAACCATATCAATGTATCGAAT

GTGGCAAAGCTTTCAGGGATAACTCATCCTTTGCACGCCATCGGAAAATTCACACTGGAGAGAAACCTTACAGATGTGGCTTGTGTGAGAAGGCTTTCAG

GGACCAGTCAGCCCTAGCACAGCATCAGAGAACTCACACTGGGGAAAAGCCTTACACGTGTAACATATGTGAGAAAGCCTTCAGTGACCATTCGGCCCTT

ACCCAACATAAGAGAATTCACACGAGAGAAAAACCGTACAAATGTAAAACCTGTGGGAAAGCTTTTATCCGAAGCACACACCTCATTCAACACCAGAGGA

TTCACACGGGAGAGAAACCTTACAAATGTAACACATGCGGGAAAGCCTTCAACCAGACTGCAAACCTCGCTCAGCACCAGAGGCATCACACTGGAGGAAA

GTGATAGAAAGGCAGTTAATAGGTGCTGAGGGGATGATGTCATTAATTATTGAATAGAAGAGAGTACATAATCACACTGAAGTCTTTTATCATCATGGTT

GGATTTACTCGGAGCCAGGTTGCCTAATGCTAAGGGTCTTGAGAATCTTATGAATGGTGAACACACCTTACTCTTCAGTCTGCCACAGTTGGATAGTAGT

GCCTTTTTATTGGCCTGAATTACTATTAGAACCAAAATGAAAATTCATTAAAAGCATAAATGTCAGTTTATC
Translation
 MAVSQLPALVQ DLVTFKDVAVLFTQEEWGQLSSAQRALYQDVMLENYSNLVSLA AGLLGSQPDMFFPLEEVEECVSEEAPEGFVLD DAADEPHLGP

RSACEAQVPVTG - UNI33405 - GEITVAMSKKFLKADIPEKESDQWIAKERACANLFNWQCQEGQEVKLQQVVLTQQNTPSKLSEQRVRAESSSPI

QSQRSQASKTAFECSECGKAFSKSSTLKKHQKLHTEKLNPSQKSPMKEKRYKCRECGKAFHQSTHLIHHQRVHTGEKPYQCKDCGKAFSVSSSLSYHQKI

HTGEKPFECNVCGKAFIRNIHLSHHHRMHTGEKPFQCNLCDKAFVCRAHLTKHQHIHSGKKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAF

RVNSSLTEHQRIHTGEKPYQCIECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRTHTGEKPYTCNICEKAFSDHSALTQHKRIHTRE

KPYKCKTCGKAFIRSTHLIQHQRIHTGEKPYKCNTCGKAFNQTANLAQHQRHHTGGK

For any suggestions or comments, please send an email to unitrap@crg.es