Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048874 (Phf3)
Chromosomal location
Chr 1: 30859187 - 30920101 (-)
Description
PHD finger protein 3 Gene [Source:MGI Symbol;Acc:MGI:2446126]
RefSeq_dna
NM_001081080 
RefSeq_peptide
NP_001074549.1 
UniGene
Mm.194486 Mm.412645 
MGI
MGI:2446126 
Uniprot/SPTREMBL
Q8VCJ7 A0PJJ1 B2RQG2 Q4FZG1 Q80U54 Q8BLA7 Q8BU94 Q9CV03 
Human Ortholog
ENSG00000118482 (PHF3)
Omim not available
UniTrap UNI5500
Vector Insertion
Chr 1: 30894112 - 30919831
Public Clones (sanger) RRR590 (baygenomics) YTA058 (baygenomics) CSH429 (baygenomics)
W254A01 (ggtc) D036H02 (ggtc) D029A01 (ggtc) D161G05 (ggtc) Q009E02 (ggtc)
D058D11 (ggtc) Q009B07 (ggtc) M122H04 (ggtc) P032C11 (ggtc) W269E04 (ggtc)
D107C06 (ggtc) IST14621B10 (tigm) IST10726F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5433
Vector Insertion
Chr 1: 30888405 - 30893949
Public Clones CSJ153 (baygenomics) F15253 (ggtc) W073E06 (ggtc) A033B07 (ggtc)
Private Clones OST198101 (lexicon) OST193279 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10382
Vector Insertion
Chr 1: 30886687 - 30887317
Public Clones CT070 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20387
Vector Insertion
Chr 1: 30877975 - 30878160
Public Clones not available
Private Clones OST364868 (lexicon) OST283791 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4645
Vector Insertion
Chr 1: 30876925 - 30877083
Public Clones AQ0010 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9600
Vector Insertion
Chr 1: 30868813 - 30869861
Public Clones RRB001 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6677
Vector Insertion
Chr 1: 30862788 - 30863013
Public Clones BGC132 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046443
Sequence
ACTAAATCTAATGTCAAGGCTGTGAAGCGAAATTCTGGTGAGCCGGAACCCCAGCCTGATTCTCAGAGGCCAGTCAAAGTGAGAAAAAAACAAGGTGATA

AGGTTTGGAAGAGTCAGAGTTGTAATTCTGGAGTTAAATCTGTGAAAAGCCAAGCTCATTCTGTATTGAAAAGAATGCCCCAGGATCAAAACACAATGCA

GATTTCCAAACCTTTAACTCATCCTCATAGTGATAAGCTTCATGGTCACTCTGGCTTCTCTAAGGAGCCTCCCCATCCTGTACAAACTGGACACTTGGTG

CATTCCAGTCAAAAACAGAGCCAGAAGCCTCAGCAGCAGGCAGCTGTGGGGAAGGGCAGTAGCCATGTGAAGGATGAGCATGACCATCCAGTCAGTGAGC

ATCTTAAGGAGGACGATAAACTGAAGCCAAGAAAACCTGATAGGAACCTGCAGCCTCGCCAAAGGAGAAGCAGCCGAAGTTTTTCTCTGGATGAGCCTCC

ATTGTTCATCCCAGACAACATAGCTACTGTAAAAAAAGAAGGGTCAGATCAGACCACCTCAATTGAAAGCAAATATATGTGGACTCCAAGCAAGCAATGT

GGGTTTTGCAAA - UNI10382 - ACCACATGGCAACAG - UNI10382 - GTTTATGGTCGGCTGTGGGAGATGTGATGACTGGTTTCATGGAGA

CTGTGTTGGATTAAGTCTTTCTCAAGCACAGCAAATGGGAGAGGAAGACAAAGAATATGTTTGTGTAAGGTGCTGTGCTGAAGAAGATAAAAAGACTGAC

ATACTAGACACAGAGATTTTTGAAGCCCAAGCTCCCATCGAAGCCCACAGCGAAGATAAAAGGATGGAGTGTGGAAAGCTGACATCATCGAAGCACGCAG

TCACTGACGATAAACACAGACACTCAGATGACCCTGGGAAGCACAAGGTCAAAATTTTAAAACGG - UNI20387 - GAGTCTGGTGAGGGAAAAACT

TCCTCTGACAGTAGAGATAATGAAATTAAAAAATGGCAGCTAGCCCCTCTTCGCAAGTTGAGCCAACCACATTTACCTCGGAGATCATCAGAAGAAAAAA

GTGAAAAAATAGCAAAGGAATCTACAGCTCTTGCCTCTACAGGAGAGAGAGTGGCGAGATCAG - UNI20387 - GTACTCATGAGAAGCAAGAGACA

AAAAAGAAGAAAATGGAAAAGGGTGGACCTAATGTGCACCCGCCTGCTGCTACTTCCAAGCCTTCTGCAGATCAGATCAGACAGAGTGTCCGACATTCTC

TCAAAGATATTCTTATGAAAAG - UNI4645 - ACTTACAGATTCAAACCTGAAGATCCCAGAGGAAAAGGCAGCAAAGGTTGCCACAAAAATTGAAA

AAGAACTTTTCTCTTTTTTTCGGGACACGGATGCCAAGTATAAGAATAAATATAGAAGCTTGATGTTTAATCTAAAAGATCCTAAAAACAAT - UNI46

45 - ATATTATTTAAGAAAGTTCTAAAAGGAGAAGTAACCCCTGATCATCTTATAAGAATGAGCCCAGAAGAACTAGCCTCCAAAGAGCTGGCTGCGTG

GAGACGAAGGGAGAACAGACAC ACCATAGAGATGATTGAGAAGGAACAGAGAGAAGTGGAAAGACGACCAATCACGAAAATAACTCACAAAGGTGAGAT

AGAAATCGAGAGTGACGCCCCGATGAAGGAGCAGGAAGCAGCCATCGAGATCCAGGTAGGAGCAGATCTGACCTATGTGGTCTGCAGCTCCAAATACGAA

GGTGGACAAAAGCTTTTCTCATGCTCTTAAAGCAGAACTTTGTTTTAAAGTAGTGAGCTTTAAAGTAGCCTGTTTTACTGGGTTAGTTCTTAAGAGCTTA

GTGCACATTGTCTGCATTGTAGGTGCCTGTTAAAAGCTTGTTAGAATCCTGGGGGTATTTGATATAGTAATTCCTTGGTGCTTTGTTTTTGTTTTGTTTT

TGTCGTTCTTTGGTTTTGGTTTTGGTTTTAAGGTGTGTATTGTAGAAAGGTAGAGAGAGAGAGAGAATAATAGAGAAGTAGAGGCTGGCCATGGCCATGT

GGAGAGGGGAAAGGGAGTGGGGAGAGAGGCGGCAAGCGGGAAGC
Translation
TKSNVKAVKRNSGEPEPQPDSQRPVKVRKKQGDKVWKSQSCNSGVKSVKSQAHSVLKRMPQDQNTMQISKPLTHPHSDKLHGHSGFSKEPPHPVQTGHLV

HSSQKQSQKPQQQAAVGKGSSHVKDEHDHPVSEHLKEDDKLKPRKPDRNLQPRQRRSSRSFSLDEPPLFIPDNIATVKKEGSDQTTSIESKYMWTPSKQC

GFCK - UNI10382 - TTWQQ - UNI10382 - VYGRLWEM - UNI20387 -  - UNI20387 -  - UNI4645 -  - UNI4645 -  

Transcript ENSMUST00000088310
Sequence
GGGTTGAAAGACACACAGAAGTCTTCATGGATATAGTTGATACATTTAATCATTTAATTCCTACTGAACACTTAGATGATGCCCTATTTCTAGGATCCAA

CCTGGAGAATGAAGTCTGTGAGGATTTTAGTACAAGTCAAAATGTCTTAGAGGACTCGCTGAAGAACATGCTCAGCGATAAGGATCCTATGCTAGGATCT

GCAAGTAACCAGTTCTGTTTGCCTGTTTTGGATAGCAATGATCCCAATTTCCAGATGCCTTGTTCAACAG - UNI5500 - TTGTTGGTCTTGACGAT

ATTATGGATGAAGGAGTTGTTAAAGAAAGTGGTAATGATACCATTGATGAAGAAGAATTGATTTTACCTAACAGGAGTTTGAGGGACAGAGTAGAAGACA

ATTCAGTAAGATCACCAAGAAAATCACCTCGTTTAATGGCACAAG - UNI5433 - AACAAGTAAGAAGTTTGCGACAAAGCACTATTGCCAAGCGTT

CAAATGCAGCAACTCTAAGCACAAAAAAGCCATCTGGGAAGACCTTATCTACCTCTAAAGTAGGGGTGAAGCCAGCAGAAAGATGTCAGGGTAAAGAAGA

AGTTTATGCCTCACTGAAATCTGAACACCCTAAGGAGAGTAGAAGGAGTGGCCGGCATGCTGAACAGATGGACGTGGCGCCAGAAGTCTCAGCATCTTCA

GTTGATTCTTCAGTGTCGTCTTGTGCTGGAATGAAGGAGGAGGCTGAGTTTGATCCCAAACATGCATGCAATAATCAGGGTGAAGTGAACGTGCCATCTC

CTGAGTTAGATTGTCCACTTCTCTCAGAGACTAGTGCTAGTGTGGAAGAGAAGAACATTGAGGCTCTGATGGAATGTAAAGCTAAGACTAACAGTAGCCC

GTTATTTAAGTTTCCAGTTAGAGAAGATGAGCAGAGTGATCTTGTTTCGGGTGAACTGAATGACACCATTGAAGGAAAGGATGCAGGGGGAAAACCTGAT

CAAGAATCAGAGGAGGTGAAGTTTCCCTGCGAAGGTGACCAGACGGCCGAGGAACCCGAATCTTCTGATGTGTCTAGTGACTCTGCTTGTGCCAATAAAA

ATAAGGCAGAAAAGAATGAAGGGGCAGAATGTCATTTGGAATTGAAGAATACTGTGGATATTGTTGATAAACCTGAGAACTCACCTCAGAGAAATGAGTT

GGAAACACTGGGCTATGGTGAGGACACGGAGTCTAATGATGCTCGGTTACAGAGCACAGAGTTCAATAAGTCAGATTTGGAGGAAGTTGATGCTTGTGCT

TTTGAACCGGAAGCTAGCACTTTAGAAAATACTATTTGTGATGTTCTTGACCAAAATTCAAAGCAATTGAATATTACTCAAAGTATTAAAATGGAAACAG

CCAATCTTCAGGATGATAGAAGTGGTTTAGAGCCCAAAAACATAAAACCCAAACACATAAAATCTGTAACTCATTCTAAACAAAGCATGACCACAGAGAC

ACCCAGAAAAACTGTGGCAGCAAAGCATGAAGTAGGTCATAGCAAAACTAAATCTAATGTCAAGGCTGTGAAGCGAAATTCTGGTGAGCCGGAACCCCAG

CCTGATTCTCAGAGGCCAGTCAAAGTGAGAAAAAAACAAGGTGATAAGGTTTGGAAGAGTCAGAGTTGTAATTCTGGAGTTAAATCTGTGAAAAGCCAAG

CTCATTCTGTATTGAAAAGAATGCCCCAGGATCAAAACACAATGCAGATTTCCAAACCTTTAACTCATCCTCATAGTGATAAGCTTCATGGTCACTCTGG

CTTCTCTAAGGAGCCTCCCCATCCTGTACAAACTGGACACTTGGTGCATTCCAGTCAAAAACAGAGCCAGAAGCCTCAGCAGCAGGCAGCTGTGGGGAAG

GGCAGTAGCCATGTGAAGGATGAGCATGACCATCCAGTCAGTGAGCATCTTAAGGAGGACGATAAACTGAAGCCAAGAAAACCTGATAGGAACCTGCAGC

CTCGCCAAAGGAGAAGCAGCCGAAGTTTTTCTCTGGATGAGCCTCCATTGTTCATCCCAGACAACATAGCTACTGTAAAAAAAGAAGGGTCAGATCAGAC

CACCTCAATTGAAAGCAAATATATGTGGACTCCAAGCAAGCAATGTGGGTTTTGCAAAAAACCACATGGCAACAG - UNI10382 - GTTTATGGTCG

GCTGTGGGAGATGTGATGACTGGTTTCATGGAGACTGTGTTGGATTAAGTCTTTCTCAAGCACAGCAAATGGGAGAGGAAGACAAAGAATATGTTTGTGT

AAGGTGCTGTGCTGAAGAAGATAAAAAGACTGACATACTAGACACAGAGATTTTTGAAGCCCAAGCTCCCATCGAAGCCCACAGCGAAGATAAAAGGATG

GAGTGTGGAAAGCTGACATCATCGAAGCACGCAGTCACTGACGATAAACACAGACACTCAGATGACCCTGGGAAGCACAAGGTCAAAATTTTAAAACGG 

- UNI20387 - GAGTCTGGTGAGGGAAAAACTTCCTCTGACAGTAGAGATAATGAAATTAAAAAATGGCAGCTAGCCCCTCTTCGCAAGTTGAGCCAA

CCACATTTACCTCGGAGATCATCAGAAGAAAAAAGTGAAAAAATAGCAAAGGAATCTACAGCTCTTGCCTCTACAGGAGAGAGAGTGGCGAGATCAG - 

UNI20387 - GTACTCATGAGAAGCAAGAGACAAAAAAGAAGAAAATGGAAAAGGGTGGACCTAATGTGCACCCGCCTGCTGCTACTTCCAAGCCTTCT

GCAGATCAGATCAGACAGAGTGTCCGACATTCTCTCAAAGATATTCTTATGAAAAG - UNI4645 - ACTTACAGATTCAAACCTGAAGATCCCAGAG

GAAAAGGCAGCAAAGGTTGCCACAAAAATTGAAAAAGAACTTTTCTCTTTTTTTCGGGACACGGATGCCAAGTATAAGAATAAATATAGAAGCTTGATGT

TTAATCTAAAAGATCCTAAAAACAAT - UNI4645 - ATATTATTTAAGAAAGTTCTAAAAGGAGAAGTAACCCCTGATCATCTTATAAGAATGAGCC

CAGAAGAACTAGCCTCCAAAGAGCTGGCTGCGTGGAGACGAAGGGAGAACAGACAC ACCATAGAGATGATTGAGAAGGAACAGAGAGAAGTGGAAAGAC

GACCAATCACGAAAATAACTCACAAAGGTGAGATAGAAATCGAGAGTGACGCCCCGATGAAGGAGCAGGAAGCAGCCATCGAGATCCAG GAACCGTCAG

CTAATAAGTCAATGGAGAAGCCAGATGTGTCTGAGAAACAAAAAGAAGAGGTTGACTCCACATCTAAAGACACCACTAGTCAACACAGACAGCATCTCTT

TGACCTGAACTGCAAAATATGCATAG - UNI9600 - GTCGAATGGCACCACCTATAGATGATCTTTCTCCAAAAACTGTGAAAGTTGTTGTAGGAGG

AGCCCGGAAACACTCAGACAACGAAGCAGAGAGTCTAGCAGATGCGTTGTCTTCAACTACGAATATTCTGACCTCTGACCTCTTTGAGGAGGAAAAGCAA

GAATCTCCCAAGTCAACGTTTTCCCCCACTCCACG GCCAGAGATGCCTGGAACTGTGGAAGTTGAGTCAACCTTTCTGGCTCGATTGAACTTCATCTGG

AAAGGTTTTATCAATATGCCCTCTGTGGCAAAGTTTGTTACCAAAGCCTACCCCGTGTCTGGATCCCCTGAGTACTTGACAGAG GACCTACCAGACAGC

ATTCAAGTAGGTGGCAGGATATCGCCTCAGACAGTTTGGGATTATGTGGAAAAAATAAAAGCATCAGGCACCAAG GAAATCTGTGTGGTTCGCTTCACA

CCAGTAACTGAAGAAGATCAGATTTCTTACACTTTGCTGTTTGCGTACTTCAGTAGCAGAAAGCGCTATGGTGTGGCTGCTAACAACATGAAGCAGGTTA

AAGACATGTACCTCATTCCATTGGGCGCTGCAGATAAAATCCCACACCCTCTTGTGCCTTTTGATGGACCTG - UNI6677 - GACTTGAGCTGCACA

GACCTAATCTGTTGTTGGGCCTGATTATCCGTCAGAAGCTGAAGCGGCCGCACAGCGCTAGTGCAGGCCCCAGTCACACAGGCGAGACTCCTGAGAGCGC

CCCAATAGTGTTGCCCCCCGACAAGAAAGGTAAAATGGAGTCATGCACAGAGGAAGCAGCAGAGGAAGAGAGTGACTTTTTCAATTCCTTTACAACTGTG

TTACACAAGCAGAGAAATAAGCCCTCACAGCCTCTTCAGGAAGACCTGCCAACAGCAGCTGAACCTCTGATGGAAGTCACCAAGCAGGAGCCACCAAAAC

CCTTAAGGTTCCTTCCTGGGGTCCTGATTGGCTGGGACAATCAACCTTCTACTCTGGAATTAGCAAATAAGCCTCTTCCTGTGGATGACATACTCCAAAG

CCTTTTGGGCACCACTGGTCAAGTATATGAGCAGGCTCAGCCACTTGTAGAACAAAGCACTCTTAAAGAAATTCCTTTTATAAATGATCAAGCTAACCCA

AAAGTAGAGAAAATAGATAAAGTGGAGGTGACTGAAGGTGACGCCAAGGAGATAAAAGTTAAAGCAGAAAATATTTCAGTGTCTACAAGTAAAAACTCAG

GAGAAGAGACTTCATCGGTAGGTTCATCTTCCATTTCTCCAGGGCCTTTGGCAAGTCTCAGTCTGAGAGGGAAACCACCAGATGTTTCTACAGAAGCATT

CTTAACAAATTTATCAATTCCCTCAAAACAAGAGGAAAGTGTGGAAAACAAAGAGAGAACATTAAAAAGACTGCTGCTCCAAGATCAAGAGAATAGTTTG

CAAGACAATAGGACTTCAAGTGACTCTCCCTGCTGGCCTGGCACTGGGAAGGGAGGCATGGATGGGGATGGGAGCGGGAGCGGGAGCGGGAGCGGGAGCG

GCAGTGAGGGTCCAGTGGCTAACACAAGAGCCCCACAGTTTATCAACCTGAAAAGGGACCCTAGGCAAGCAGCAGGACGAAGTCAGCAGACAGCTTCTGA

AAGCAAGGATGCAGAGAGCTGCAGAAATGGAGACAAGCATGCTGCGTCTGCTCCACCACACAACAAAGAGCCCTTAGCAGAGGCTGTCGGTGGAGAGGGA

AAGCTGCCTTCGCAGGAGAAGAGCTCATGTGTAGAGCAGAACGACGATTCGGAAGCTGCACCAAACTCATCCTCAGTAGAAAACTTAAATTCGTCACAAG

CAGAACAAGCCAATCCTTCACAAGAGGATGTTTTAACACAAAATATTGAAACGGTCCACCCGTTTAGAAGAGGATCGGCTCCAACATCATCTCGTTTTGA

AGGTGGAAATACCTGCCAATCAGAATTTCCGTCTAAAAGCGTTAGCTTTACTTGCAGGAGTAGCAGCCCTCGCGCGAGTACAAACTTTTCACCTATGAGG

CCACAGCAGCCCAATCTCCAGCACCTCAAGTCCAGTCCTCCTGGATTCCCATTTCCAGGACCCCAAAACTTCCCTCCGCAAAATATGTTTGGATTCCCAC

CACATTTGTCACCTCCGTTACTTCCCCCTCCAGGCTTCGGCTTCCCTCAAAATCCCCCCATGGTTCCTTGGCCACCTGTTCATGTCCCAGGCCAACCACA

ACGCATGATGGGGCCCCTTTCACAAGCATCACGGTACATGGGCCCACAAAATTTTTATCAGGTAAAAGATATTCGGAGACCAGAAAGGCGCCATAGTGAC

CCATGGGGTAGGCAAGACCAACAACAACCAGATAGGCCATTTAATAGGGGTAAAGGGGACCGACAGAGATTTTACAGTGATTCGCACCACTTGAAAAGAG

AGCGTCACGACAAGGATTGGGAGCAGGAATCCGAAAGGCACAGACACAGAGACAGAAGCCAAGAAAGGGACAGAGACAGAAAAAGCAAAGAGGAAGCAGC

GGCACACAAAGACAAGGAGAGACCGCGGCTCTCACACGGCGACCGGGCACCAGATGGGAAAGCAAGCAGAGATGGTAAGAGTGCAGACAAGAAACCGGAC

AGGCCTAAAGGCGAAGACCACGAAAAGGAGAAAGAGAGAGACAAGAGCAAGCACAAAGAAGGGGAGAAGGACAGAGAGCGGTACCACAAAGACAGGGACC

ACACCGACAGAGTGAAAAGCAAAAGGTGAAACTGGAGGCTGCTTTAGCGTCTTACATGTGTGTCTTTATAAGATTGCCTGGTAGGACTGTGCCATCTTAA

CCCTCGGATTGCTGCTTGGCAGAGCAGTAAACTATGCTGGTGCACGGTCCTGTGACCAGTGCCCTCCGCCCCTTCTTTACACCACTGTCCTACCTACAGG

AATTTAATATTTTTAAAGTTTTACAATACTGTATATTCAAAGATTTGTTTAATTAATATGCAATAAAGGCTTAGAAATTTTAGTTTTATTCCTTAATTGG

TAAATATGGTTAACTATGAAATATATTTCCTGCCTCTAGTGAATGTCCTTTCTATAATGACTAATTTGAAAGTAATCTGTGCTCTGTACATTTGTTTTCA

ATTGCACTGTTTTTAAAGAAAATGTAGAGGAGCAGCAAAAAAGCCAAGCGACTTCCCGATGAGACCATACTATTTAGGTGGCAGTTTTTGACTGTATCAC

GACCCCAGGGAGGTCATGGGTTGCTTTAATCTGTGCTCATTGAAGGCGTTTCTTACCATGTACTGCAGTTTGTGGTAGGCCATATCCCTTTCCTTTCTGG

CTCTTCAGAAACTTGAATACTTAAGCTTGTACATGATCTTGTGTTTTGCTATCCTTTTTACTGTAAAATGTAAATATTTTAAGGGATATTTTGATTCTAA

ATATGATAAAAGAATTTCTCACCTACTTTGTGTGTGTGATTTGAAATTCAGTAGTAAAAGAGATTCTTCGAAGCTTCTTCTCAAGACATTATTATTTTAC

TCAGCCAAGAGTATGTAGATACACTGTCAGACACGGCCTAAGAGAGGAATGGCTTTCTTACATCTTAGATGATTCACGTCTAAAGAGGCTAGTGCTTAGA

ACTTCCAGCAGATAGCTCTGCAGTTACCCACTTAGTTGCTGTTATGTTTCTGGAAGCTTACATATGATTAAACACAGTAATCATTATAAAACTGCAGAAC

TTAAGTGAAATGTATTTTGATTTTTGATTTTTTTGTGGGGGGGTAAAGTGATTTGTTTGTAGGGCAACTGTAAAACTGAGTATGCCAGTTTGACTTGAAA

TAGAAAATACACAAGACTGTTGTTCTTTCAGATCTAAATTTATCTACACCCCGAAATACATCTTATGCTGATGTTTAAAACCTAAAGCAGTAGCTGCCAG

ATGATGCTAACACTCGAGACCCCACTCAAGAGCGATCAGTTCTTATCTACTTGTACCCATGAAGAAGAATTCCAGTAACTCCACAAAATTAAGAGAACTG

TTTTTAAAGGATTACCAGGTTTTTGAAACCGAATTAACCTTGCTAGAGAAAACAGCAGTCAAACATTTTGTCTGAATTGCAAGGATTGCAGTATATTTTT

TTTCCATCTTTACCTCTGAAATTTATCATCATCATGAAAGTTCTAAAATGAAGGATTTCCGTTTAAATAAAGTATTTTCAACGTTT
Translation
MDIVDTFNHLIPTEHLDDALFLGSNLENEVCEDFSTSQNVLEDSLKNMLSDKDPMLGSASNQFCLPVLDSNDPNFQMPCSTV - UNI5500 - VVGLD

DIMDEGVVKESGNDTIDEEELILPNRSLRDRVEDNSVRSPRKSPRLMAQE - UNI5433 - EQVRSLRQSTIAKRSNAATLSTKKPSGKTLSTSKVGV

KPAERCQGKEEVYASLKSEHPKESRRSGRHAEQMDVAPEVSASSVDSSVSSCAGMKEEAEFDPKHACNNQGEVNVPSPELDCPLLSETSASVEEKNIEAL

MECKAKTNSSPLFKFPVREDEQSDLVSGELNDTIEGKDAGGKPDQESEEVKFPCEGDQTAEEPESSDVSSDSACANKNKAEKNEGAECHLELKNTVDIVD

KPENSPQRNELETLGYGEDTESNDARLQSTEFNKSDLEEVDACAFEPEASTLENTICDVLDQNSKQLNITQSIKMETANLQDDRSGLEPKNIKPKHIKSV

THSKQSMTTETPRKTVAAKHEVGHSKTKSNVKAVKRNSGEPEPQPDSQRPVKVRKKQGDKVWKSQSCNSGVKSVKSQAHSVLKRMPQDQNTMQISKPLTH

PHSDKLHGHSGFSKEPPHPVQTGHLVHSSQKQSQKPQQQAAVGKGSSHVKDEHDHPVSEHLKEDDKLKPRKPDRNLQPRQRRSSRSFSLDEPPLFIPDNI

ATVKKEGSDQTTSIESKYMWTPSKQCGFCKKPHGNR - UNI10382 - RFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVRCCAEEDKKTDI

LDTEIFEAQAPIEAHSEDKRMECGKLTSSKHAVTDDKHRHSDDPGKHKVKILKR - UNI20387 - ESGEGKTSSDSRDNEIKKWQLAPLRKLSQPHL

PRRSSEEKSEKIAKESTALASTGERVARSG - UNI20387 - GTHEKQETKKKKMEKGGPNVHPPAATSKPSADQIRQSVRHSLKDILMKR - UNI4

645 - RLTDSNLKIPEEKAAKVATKIEKELFSFFRDTDAKYKNKYRSLMFNLKDPKNN - UNI4645 - ILFKKVLKGEVTPDHLIRMSPEELASKE

LAAWRRRENRH TIEMIEKEQREVERRPITKITHKGEIEIESDAPMKEQEAAIEIQ EPSANKSMEKPDVSEKQKEEVDSTSKDTTSQHRQHLFDLNCKI

CIG - UNI9600 - GRMAPPIDDLSPKTVKVVVGGARKHSDNEAESLADALSSTTNILTSDLFEEEKQESPKSTFSPTPR RPEMPGTVEVESTFLAR

LNFIWKGFINMPSVAKFVTKAYPVSGSPEYLTE DLPDSIQVGGRISPQTVWDYVEKIKASGTK EICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAA

NNMKQVKDMYLIPLGAADKIPHPLVPFDGPG - UNI6677 - GLELHRPNLLLGLIIRQKLKRPHSASAGPSHTGETPESAPIVLPPDKKGKMESCTE

EAAEEESDFFNSFTTVLHKQRNKPSQPLQEDLPTAAEPLMEVTKQEPPKPLRFLPGVLIGWDNQPSTLELANKPLPVDDILQSLLGTTGQVYEQAQPLVE

QSTLKEIPFINDQANPKVEKIDKVEVTEGDAKEIKVKAENISVSTSKNSGEETSSVGSSSISPGPLASLSLRGKPPDVSTEAFLTNLSIPSKQEESVENK

ERTLKRLLLQDQENSLQDNRTSSDSPCWPGTGKGGMDGDGSGSGSGSGSGSEGPVANTRAPQFINLKRDPRQAAGRSQQTASESKDAESCRNGDKHAASA

PPHNKEPLAEAVGGEGKLPSQEKSSCVEQNDDSEAAPNSSSVENLNSSQAEQANPSQEDVLTQNIETVHPFRRGSAPTSSRFEGGNTCQSEFPSKSVSFT

CRSSSPRASTNFSPMRPQQPNLQHLKSSPPGFPFPGPQNFPPQNMFGFPPHLSPPLLPPPGFGFPQNPPMVPWPPVHVPGQPQRMMGPLSQASRYMGPQN

FYQVKDIRRPERRHSDPWGRQDQQQPDRPFNRGKGDRQRFYSDSHHLKRERHDKDWEQESERHRHRDRSQERDRDRKSKEEAAAHKDKERPRLSHGDRAP

DGKASRDGKSADKKPDRPKGEDHEKEKERDKSKHKEGEKDRERYHKDRDHTDRVKSKR

For any suggestions or comments, please send an email to unitrap@crg.es