Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000048997 (Atxn7l2)
Chromosomal location
Chr 3: 108005140 - 108013852 (-)
Description
ataxin 7-like 2 Gene [Source:MGI (curated);Acc:Atxn7l2-001]
RefSeq_dna
NM_175183 
RefSeq_peptide
NP_780392.1 
MGI
MGI:1919772 
Uniprot/SPTREMBL
Q6KAM3 A2AE44 Q5HZJ2 Q8C8K6 
Human Ortholog
ENSG00000162650 (ATXN7L2)
Omim not available
UniTrap UNI19513
Vector Insertion
Chr 3: 108011186 - 108011357
Public Clones not available
Private Clones OST389890 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20487
Vector Insertion
Chr 3: 108010880 - 108010986
Public Clones not available
Private Clones OST360809 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19610
Vector Insertion
Chr 3: 108009227 - 108009740
Public Clones not available
Private Clones OST386148 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090581
Sequence
ATCACGTGTGGTTGGTGCCCACATACAGGAAAGCCCATACACTTTGGGTCTGGTCAGATGGACTGGGGAGGCTGGGAGCGTCCAGCAGAACTATCAGTTG

GAAGGCTGAGCGTCTTCTAAGTGGTGGCGTTGAGAGTGTTCCTTGAGCTAGGGAAATCCGGAGAATTTGACCCGAGTGATAAAGGGTTCTGTCGTTGCAG

ACATGTCCATCTTCGGGCACTGCCCTGCCCATGATGACTTCTATTTGGTTGTATGTAACCACTGCAGCCAGGTGGTGAAGCCCCAAGCCTTCCAGAAGCA

TTGCG - UNI20487 - AAAGAAGACATGGGCCCCTCAGCAAGCTTTATGCCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCTCTCAAAAATGCC

ATGTAGTGAATGGGCAGGGCCCAGCTTGTAGAGCCCCAGGTTCCACCAAAACCTCCTCCAGGGAGAAGGGCCAGGGGTCCCGGAGCCGTGGCCATCAGCC

TCCTGAGAAGACCCAGAAGGACAGCCTCTG CCTTTTCGTGCCTGTGGTGAATCTGGAGAAGATATCCAGTCTCCCGAAACCTGATGCACATGGAGTCAG

GGTGGCCCCACCCTCTGCTCTCCTCAGTCAGCCAGGAGGCCTCCCCAAGGACTCCCCTGGAAAAGTCCCCACGGCCCCCTCTCCTAAAGAACCTCCTGGC

AGAGAGAACATCGAGCTTGTCCCCGGTGAGGGCTCCAGTCACCGCGCCGAAGGCAGCCCCCCGGAGAAGGAGGCCAGTGGAGCCAGGCTTCCTCCTAAAA

CCCACCGAAAGATGGCTCGTGAGTAGTTATGGACGTGGGACTCAGAAAGGCGGAGTGGAGACCTCACTGGGCTTCTCTGTTCTTGGGTCAGGAAGGAGTG

AACCTGTCCAGGTCTGACCATTACCGCTTGGAGGGTGTGGCAGCCCCATTACCTCCTGTCCTGCTTGTTCCCAGAAAGCCTTGCTGGTCCAGGTCTCTGA

GGTAGTCTGAGAGAACACGAGGCTAAGCCAGCAGAGTCACTCATACCTGCCTTGACCATTCTCTCCTTCCCCACATCCTACAGCTGTTTTTCCTGACATC

TAAGATGTAGGTAGCTGCTTTTGCTTCTTGGTACCGACTGCCCTGCTTTGGGCTTCCAGTCTTCCAAGAGTACCTGGGCCAGGCATAGGGCTGAGTTGGT

TTAAACCCAAGGGTGAGGCTCTCCTGCCTTAGTCCTACTGCTTCCTGGGCCCTTGGCAGGAAGAGGCCAGATTCTTCCTTGGCTCCTCCCCCAAATGGAC

TTGCGATTCATTGGAACCTCTTTCCCCCACAGGGAAGGAGTTCGACCTCAACAGGCAGTGCGGGGTCATAAATCCAGAGACCAAGAAGATCTGTACACGC

CTATTGACTTGCAAG ATCCACTCAGTGCACCAGCGCAGGGAGGTCCCAGGCAGGGCCAAGGACTTTGATGTGCTAGTGGCCGAACTGAAGGCCAGCTCC

CGAAAAGGAGAGTCTCCCAAGGAGAAGAGCCCAGCACACAAAGAGCCAGCTCTGGAGCGCCCATCCCAGGAGCCTCCCACTGCAGTCCAGGGTGTGGCAG

CGGTAGCTGCCCCCAACACCACCTTCTCTTCTCTGTCTAAGCAGACCTATCCGTACTGTGCACTCCCCAGGTATGTA CTTGTCAGTCCATCTTTATCTG

ATCCCTTGAGTCCATCCCCTATGGGCAGCTGTCCCCGACTTCCAGGTCCAGCCCCCCGACCTGCCTGTCCAGCCTCCATACCCCCCGTCAAGGACAGCCT

TGTCCCTAGCTATCCTGCAGGCTCCCCCAGTGTAGCAGCTGCCTGCAGCCAGGCAGAGTGCATGGGCGGTAGCCAGGCTATTACCTCACCGCTGCCTGCC

AACACTCCATCTCCGTCCTTCAGCAAGCTGCCACCTTCCAAGGCCAGCAAGTCATCCAAAGGCAAGGAGGGGGTGGAGATGGAGGCCCCTTCTCGAAAGC

GGAAGTTATCCCCTGGCCCCACCACCTTCAAACGGACCTGCATCCTGGAGCCTGCTGGAAAGGGCAAACCCTCTAGCTGTCGGGGTCTCTCAACCAAGAC

TAAAACAGCCCTGAACTTGGGGCTTAATGGAACAGTGGGGCCACGAGTGAAACGGGCCGGTCCCCTGGACTGTCGGGGTTCCCCTCATCCATCCCCCATA

CCCGTCAAGGCTTCTCAGCTAGAAAACCGAGGAGTGGCCGGACACCCAGCTAAGGTCCTGCCAACCACCTGCCTCTCCGAGGAGGAGGTAGCCAAGAAGC

GGAAAAACCTGGCCACTTACTGCCGGCCAGTCAAGGCCAAGCACTGTCAGGCTGGTGTCCCTCCTGATGGGACCTGCTCTGTGCGTCGCAAGAAGCCAGG

TCCAGCCCTGCCCTTTGAGGAGAAGTGCTCTACACTGAAGGTACCAATCCAGCTTCCTGAAGAC
Translation
 - UNI20487 -  SYCFLGPWQEEARFFLGSSPKWTCDSLEPLSPTGKEFDLNRQCGVINPETKKICTRLLTCK IHSVHQRREVPGRAKDFDVLVAE

LKASSRKGESPKEKSPAHKEPALERPSQEPPTAVQGVAAVAAPNTTFSSLSKQTYPYCALPRYV LVSPSLSDPLSPSPMGSCPRLPGPAPRPACPASIP

PVKDSLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSKGKEGVEMEAPSRKRKLSPGPTTFKRTCILEPAGKGKPSSCR

GLSTKTKTALNLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKASQLENRGVAGHPAKVLPTTCLSEEEVAKKRKNLATYCRPVKAKHCQAGVPPDGTCSV

RRKKPGPALPFEEKCSTLKVPIQLPED
Transcript ENSMUST00000117784
Sequence
CGTGAACGCGCGGTGGCAGCAATGGCCGCTCTGGAGCGGCGAGTGCCGAGTCTCGATGACTTCGCGGGACAGAGCTGGAGCTCGTGGGTGGAGCGGGCCG

ACCTGCCTGCGGCAGACG GGGCTGAACTAGAGGAGAACAGCAAAAACACGAAGAAACTTGACGCCATGACCCTCATTAAAGAAG - UNI19513 - -

 UNI20487 - ACATGTCCATCTTCGGGCACTGCCCTGCCCATGATGACTTCTATTTGGTTGTATGTAACCACTGCAGCCAGGTGGTGAAGCCCCAAGC

CTTCCAGAAGCATTGCG - UNI20487 - AAAGAAGACATGGGCCCCTCAGCAAGCTTTATGCCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCT

CTCAAAAATGCCATGTAGTGAATGGGCAGGGCCCAGCTTGTAGAGCCCCAGGTTCCACCAAAACCTCCTCCAGGGAGAAGGGCCAGGGGTCCCGGAGCCG

TGGCCATCAGCCTCCTGAGAAGACCCAGAAGGACAGCCTCTG CCTTTTCGTGCCTGTGGTGAATCTGGAGAAGATATCCAGTCTCCCGAAACCTGATGC

ACATGGAGTCAGGGTGGCCCCACCCTCTGCTCTCCTCAGTCAGCCAGGAGGCCTCCCCAAGGACTCCCCTGGAAAAGTCCCCACGGCCCCCTCTCCTAAA

GAACCTCCTGGCAGAGAGAACATCGAGCTTGTCCCCGGTGAGGGCTCCAGTCACCGCGCCGAAGGCAGCCCCCCGGAGAAGGAGGCCAGTGGAGCCAGGC

TTCCTCCTAAAACCCACCGAAAGATGGCTC - UNI19610 - GGAAGGAGTTCGACCTCAACAGGCAGTGCGGGGTCATAAATCCAGAGACCAAGAAG

ATCTGTACACGCCTATTGACTTGCAAG ATCCACTCAGTGCACCAGCGCAGGGAGGTCCCAGGCAGGGCCAAGGACTTTGATGTGCTAGTGGCCGAACTG

AAGGCCAGCTCCCGAAAAGGAGAGTCTCCCAAGGAGAAGAGCCCAGCACACAAAGAGCCAGCTCTGGAGCGCCCATCCCAGGAGCCTCCCACTGCAGTCC

AGGGTGTGGCAGCGGTAGCTGCCCCCAACACCACCTTCTCTTCTCTGTCTAAGCAGACCTATCCGTACTGTGCACTCCCCAG GTCCCATGCCTCCTCTG

AGAGTGAGGTGGATGACGAAGGTCCCTGTGGTGGTGATGGGGATCCAGGCCTATTCCCCTTCCCTCTGCCCCGGGGTGGGGCCCAGGCCTCCAGTGAGGA

GAGTGAGGAGGAGGGGATATCTGATGACCTCCACCTTTCCCCTGACTGCCATTACGCAACTCGGCCCCCCAGGCCACAGGCG TTTTGCACATTTGGAAG

CCGGCTGGTGAGCCCAGGATGCTATGTGTTTAGCCGCCGGCTGGACCGGTTTTGCTCAGCACTCAGCTCCATGCTGGAACGGCATCTCAGCTCACACATG

TGGAA GAAAATCCCACCAGCAGCCGAGCCTCCATCCCATCTTGTCAGTCCATCTTTATCTGATCCCTTGAGTCCATCCCCTATGGGCAGCTGTCCCCGA

CTTCCAGGTCCAGCCCCCCGACCTGCCTGTCCAGCCTCCATACCCCCCGTCAAGGACAGCCTTGTCCCTAGCTATCCTGCAGGCTCCCCCAGTGTAGCAG

CTGCCTGCAGCCAGGCAGAGTGCATGGGCGGTAGCCAGGCTATTACCTCACCGCTGCCTGCCAACACTCCATCTCCGTCCTTCAGCAAGCTGCCACCTTC

CAAGGCCAGCAAGTCATCCAAAGGCAAGGAGGGGGTGGAGATGGAGGCCCCTTCTCGAAAGCGGAAGTTATCCCCTGGCCCCACCACCTTCAAACGGACC

TGCATCCTGGAGCCTGCTGGAAAGGGCAAACCCTCTAGCTGTCGGGGTCTCTCAACCAAGACTAAAACAGCCCTGAACTTGGGGCTTAATGGAACAGTGG

GGCCACGAGTGAAACGGGCCGGTCCCCTGGACTGTCGGGGTTCCCCTCATCCATCCCCCATACCCGTCAAGGCTTCTCAGCTAGAAAACCGAGGAGTGGC

CGGACACCCAGCTAAGGTCCTGCCAACCACCTGCCTCTCCGAGGAGGAGGTAGCCAAGAAGCGGAAAAACCTGGCCACTTACTGCCGGCCAGTCAAGGCC

AAGCACTGTCAGGCTGGTGTCCCTCCTGATGGGACCTGCTCTGTGCGTCGCAAGAAGCCAGGTCCAGCCCTGCCCTTTGAGGAGAAGTGCTCTACACTGA

AG TCAAAAGCTCATTAACGAGAAAGTGCCTGCCCACTGCAACGGAGCCGCCAGCACCTCCTCCCCTCCAGATCTGGGCCCCAGGCTGCTGCCGCTTTTT

ATAACTTTATATTATTTTTTTTAAGAAAAAAAAAAAACTCTTTAAAATA
Translation
 MTLIKED - UNI19513 - - UNI20487 - DMSIFGHCPAHDDFYLVVCNHCSQVVKPQAFQKHCE - UNI20487 - ERRHGPLSKLYARAP

PPPPAPASSQKCHVVNGQGPACRAPGSTKTSSREKGQGSRSRGHQPPEKTQKDSLC CLFVPVVNLEKISSLPKPDAHGVRVAPPSALLSQPGGLPKDSP

GKVPTAPSPKEPPGRENIELVPGEGSSHRAEGSPPEKEASGARLPPKTHRKMAR - UNI19610 - RKEFDLNRQCGVINPETKKICTRLLTCK IHS

VHQRREVPGRAKDFDVLVAELKASSRKGESPKEKSPAHKEPALERPSQEPPTAVQGVAAVAAPNTTFSSLSKQTYPYCALPR RSHASSESEVDDEGPCG

GDGDPGLFPFPLPRGGAQASSEESEEEGISDDLHLSPDCHYATRPPRPQA FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMWK KKIPPAA

EPPSHLVSPSLSDPLSPSPMGSCPRLPGPAPRPACPASIPPVKDSLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSKG

KEGVEMEAPSRKRKLSPGPTTFKRTCILEPAGKGKPSSCRGLSTKTKTALNLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKASQLENRGVAGHPAKVLP

TTCLSEEEVAKKRKNLATYCRPVKAKHCQAGVPPDGTCSVRRKKPGPALPFEEKCSTLK SKAH
Transcript ENSMUST00000119650
Sequence
GGTGCGTGAACGCGCGGTGGCAGCAATGGCCGCTCTGGAGCGGCGAGTGCCGAGTCTCGATGACTTCGCGGGACAGAGCTGGAGCTCGTGGGTGGAGCGG

GCCGACCTGCCTGCGGCAGACG GGGCTGAACTAGAGGAGAACAGCAAAAACACGAAGAAACTTGACGCCATGACCCTCATTAAAGAAG - UNI19513

 - - UNI20487 - AAAGAAGACATGGGCCCCTCAGCAAGCTTTATGCCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCTCTCAAAAATGCCATG

TAGTGAATGGGCAGGGCCCAGCTTGTAGAGCCCCAGGTTCCACCAAAACCTCCTCCAGGGAGAAGGGCCAGGGGTCCCGGAGCCGTGGCCATCAGCCTCC

TGAGAAGACCCAGAAGGACAGCCTCTG CCTTTTCGTGCCTGTGGTGAATCTGGAGAAGATATCCAGTCTCCCGAAACCTGATGCACATGGAGTCAGGGT

GGCCCCACCCTCTGCTCTCCTCAGTCAGCCAGGAGGCCTCCCCAAGGACTCCCCTGGAAAAGTCCCCACGGCCCCCTCTCCTAAAGAACCTCCTGGCAGA

GAGAACATCGAGCTTGTCCCCGGTGAGGGCTCCAGTCACCGCGCCGAAGGCAGCCCCCCGGAGAAGGAGGCCAGTGGAGCCAGGCTTCCTCCTAAAACCC

ACCGAAAGATGGCTC - UNI19610 - GGAAGGAGTTCGACCTCAACAGGCAGTGCGGGGTCATAAATCCAGAGACCAAGAAGATCTGTACACGCCTA

TTGACTTGCAAG ATCCACTCAGTGCACCAGCGCAGGGAGGTCCCAGGCAGGGCCAAGGACTTTGATGTGCTAGTGGCCGAACTGAAGGCCAGCTCCCGA

AAAGGAGAGTCTCCCAAGGAGAAGAGCCCAGCACACAAAGAGCCAGCTCTGGAGCGCCCATCCCAGGAGCCTCCCACTGCAGTCCAGGGTGTGGCAGCGG

TAGCTGCCCCCAACACCACCTTCTCTTCTCTGTCTAAGCAGACCTATCCGTACTGTGCACTCCCCAG GTCCCATGCCTCCTCTGAGAGTGAGGTGGATG

ACGAAGGTCCCTGTGGTGGTGATGGGGATCCAGGCCTATTCCCCTTCCCTCTGCCCCGGGGTGGGGCCCAGGCCTCCAGTGAGGAGAGTGAGGAGGAGGG

GATATCTGATGACCTCCACCTTTCCCCTGACTGCCATTACGCAACTCGGCCCCCCAGGCCACAGGCG TTTTGCACATTTGGAAGCCGGCTGGTGAGCCC

AGGATGCTATGTGTTTAGCCGCCGGCTGGACCGGTTTTGCTCAGCACTCAGCTCCATGCTGGAACGGCATCTCAGCTCACACATGTGGAA GAAAATCCC

ACCAGCAGCCGAGCCTCCATCCCATCTTGTCAGTCCATCTTTATCTGATCCCTTGAGTCCATCCCCTATGGGCAGCTGTCCCCGACTTCCAGGTCCAGCC

CCCCGACCTGCCTGTCCAGCCTCCATACCCCCCGTCAAGGACAGCCTTGTCCCTAGCTATCCTGCAGGCTCCCCCAGTGTAGCAGCTGCCTGCAGCCAGG

CAGAGTGCATGGGCGGTAGCCAGGCTATTACCTCACCGCTGCCTGCCAACACTCCATCTCCGTCCTTCAGCAAGCTGCCACCTTCCAAGGCCAGCAAGTC

ATCCAAAGGCAAGGAGGGGGTGGAGATGGAGGCCCCTTCTCGAAAGCGGAAGTTATCCCCTGGCCCCACCACCTTCAAACGGACCTGCATCCTGGAGCCT

GCTGGAAAGGGCAAACCCTCTAGCTGTCGGGGTCTCTCAACCAAGACTAAAACAGCCCTGAACTTGGGGCTTAATGGAACAGTGGGGCCACGAGTGAAAC

GGGCCGGTCCCCTGGACTGTCGGGGTTCCCCTCATCCATCCCCCATACCCGTCAAGGCTTCTCAGCTAGAAAACCGAGGAGTGGCCGGACACCCAGCTAA

GGTCCTGCCAACCACCTGCCTCTCCGAGGAGGAGGTAGCCAAGAAGCGGAAAAACCTGGCCACTTACTGCCGGCCAGTCAAGGCCAAGCACTGTCAGGCT

GGTGTCCCTCCTGATGGGACCTGCTCTGTGCGTCGCAAGAAGCCAGGTCCAGCCCTGCCCTTTGAGGAGAAGTGCTCTACACTGAAG TCAAAAGCTCAT

TAACGAGAAAGTGCCTGCCCACTGCAACGGAGCCGCCAGCACCTCCTCCCCTCCAGATCTGGGCCCCAGGCTGCTGCCGCTTTTTATAACTTTATATTAT

TTTTTTTAAGAAAAAAAAAAAA
Translation
 MTLIKEE - UNI19513 - - UNI20487 - ERRHGPLSKLYARAPPPPPAPASSQKCHVVNGQGPACRAPGSTKTSSREKGQGSRSRGHQPPEKT

QKDSLC CLFVPVVNLEKISSLPKPDAHGVRVAPPSALLSQPGGLPKDSPGKVPTAPSPKEPPGRENIELVPGEGSSHRAEGSPPEKEASGARLPPKTHR

KMAR - UNI19610 - RKEFDLNRQCGVINPETKKICTRLLTCK IHSVHQRREVPGRAKDFDVLVAELKASSRKGESPKEKSPAHKEPALERPSQEP

PTAVQGVAAVAAPNTTFSSLSKQTYPYCALPR RSHASSESEVDDEGPCGGDGDPGLFPFPLPRGGAQASSEESEEEGISDDLHLSPDCHYATRPPRPQA

 FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMWK KKIPPAAEPPSHLVSPSLSDPLSPSPMGSCPRLPGPAPRPACPASIPPVKDSLVPSY

PAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSKGKEGVEMEAPSRKRKLSPGPTTFKRTCILEPAGKGKPSSCRGLSTKTKTAL

NLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKASQLENRGVAGHPAKVLPTTCLSEEEVAKKRKNLATYCRPVKAKHCQAGVPPDGTCSVRRKKPGPALP

FEEKCSTLK SKAH
Transcript ENSMUST00000117409
Sequence
GCGTCCGCGGCGGTGATGGCGGTGCGTGAACGCGCGGTGGCAGCAATGGCCGCTCTGGAGCGGCGAGTGCCGAGTCTCGATGACTTCGCGGGACAGAGCT

GGAGCTCGTGGGTGGAGCGGGCCGACCTGCCTGCGGCAGACG GGGCTGAACTAGAGGAGAACAGCAAAAACACGAAGAAACTTGACGCCATGACCCTCA

TTAAAGAAG - UNI19513 - - UNI20487 - ACATGTCCATCTTCGGGCACTGCCCTGCCCATGATGACTTCTATTTGGTTGTATGTAACCACTG

CAGCCAGGTGGTGAAGCCCCAAGCCTTCCAGAAGCATTGCG - UNI20487 - AAAGAAGACATGGGCCCCTCAGCAAGCTTTATGCCCGGGCCCCAC

CCCCACCTCCAGCCCCTGCCAGCTCTCAAAAATGCCATGTAGTGAATGGGCAGGGCCCAGCTTGTAGAGCCCCAGGTTCCACCAAAACCTCCTCCAGGGA

GAAGGGCCAGGGGTCCCGGAGCCGTGGCCATCAGCCTCCTGAGAAGACCCAGAAGGACAGCCTCTG TCAGCCAGGAGGCCTCCCCAAGGACTCCCCTGG

AAAAGTCCCCACGGCCCCCTCTCCTAAAGAACCTCCTGGCAGAGAGAACATCGAGCTTGTCCCCGGTGAGGGCTCCAGTCACCGCGCCGAAGGCAGCCCC

CCGGAGAAGGAGGCCAGTGGAGCCAGGCTTCCTCCTAAAACCCACCGAAAGATGGCTC - UNI19610 - GGAAGGAGTTCGACCTCAACAGGCAGTG

CGGGGTCATAAATCCAGAGACCAAGAAGATCTGTACACGCCTATTGACTTGCAAG ATCCACTCAGTGCACCAGCGCAGGGAGGTCCCAGGCAGGGCCAA

GGACTTTGATGTGCTAGTGGCCGAACTGAAGGCCAGCTCCCGAAAAGGAGAGTCTCCCAAGGAGAAGAGCCCAGCACACAAAGAGCCAGCTCTGGAGCGC

CCATCCCAGGAGCCTCCCACTGCAGTCCAGGGTGTGGCAGCGGTAGCTGCCCCCAACACCACCTTCTCTTCTCTGTCTAAGCAGACCTATCCGTACTGTG

CACTCCCCAG GTCCCATGCCTCCTCTGAGAGTGAGGTGGATGACGAAGGTCCCTGTGGTGGTGATGGGGATCCAGGCCTATTCCCCTTCCCTCTGCCCC

GGGGTGGGGCCCAGGCCTCCAGTGAGGAGAGTGAGGAGGAGGGGATATCTGATGACCTCCACCTTTCCCCTGACTGCCATTACGCAACTCGGCCCCCCAG

GCCACAGGCG TTTTGCACATTTGGAAGCCGGCTGGTGAGCCCAGGATGCTATGTGTTTAGCCGCCGGCTGGACCGGTTTTGCTCAGCACTCAGCTCCAT

GCTGGAACGGCATCTCAGCTCACACATGTGGAA GAAAATCCCACCAGCAGCCGAGCCTCCATCCCATCTTGTCAGTCCATCTTTATCTGATCCCTTGAG

TCCATCCCCTATGGGCAGCTGTCCCCGACTTCCAGGTCCAGCCCCCCGACCTGCCTGTCCAGCCTCCATACCCCCCGTCAAGGACAGCCTTGTCCCTAGC

TATCCTGCAGGCTCCCCCAGTGTAGCAGCTGCCTGCAGCCAGGCAGAGTGCATGGGCGGTAGCCAGGCTATTACCTCACCGCTGCCTGCCAACACTCCAT

CTCCGTCCTTCAGCAAGCTGCCACCTTCCAAGGCCAGCAAGTCATCCAAAGGCAAGGAGGGGGTGGAGATGGAGGCCCCTTCTCGAAAGCGGAAGTTATC

CCCTGGCCCCACCACCTTCAAACGGACCTGCATCCTGGAGCCTGCTGGAAAGGGCAAACCCTCTAGCTGTCGGGGTCTCTCAACCAAGACTAAAACAGCC

CTGAACTTGGGGCTTAATGGAACAGTGGGGCCACGAGTGAAACGGGCCGGTCCCCTGGACTGTCGGGGTTCCCCTCATCCATCCCCCATACCCGTCAAGG

CTTCTCAGCTAGAAAACCGAGGAGTGGCCGGACACCCAGCTAAGGTCCTGCCAACCACCTGCCTCTCCGAGGAGGAGGTAGCCAAGAAGCGGAAAAACCT

GGCCACTTACTGCCGGCCAGTCAAGGCCAAGCACTGTCAGGCTGGTGTCCCTCCTGATGGGACCTGCTCTGTGCGTCGCAAGAAGCCAGGTCCAGCCCTG

CCCTTTGAGGAGAAGTGCTCTACACTGAAG TCAAAAGCTCATTAACGAGAAAGTGCCTGCCCACTGCAACGGAGCCGCCAGCACCTCCTCCCCTCCAGA

TCTGGGCCCCAGGCTGCTGCCGCTTTTTATAACTTTATATTATTTTTTTTAAGAAAAAAAAAAAACTCTTTAAAATACCTCAA
Translation
 MTLIKED - UNI19513 - - UNI20487 - DMSIFGHCPAHDDFYLVVCNHCSQVVKPQAFQKHCE - UNI20487 - ERRHGPLSKLYARAP

PPPPAPASSQKCHVVNGQGPACRAPGSTKTSSREKGQGSRSRGHQPPEKTQKDSLC CQPGGLPKDSPGKVPTAPSPKEPPGRENIELVPGEGSSHRAEG

SPPEKEASGARLPPKTHRKMAR - UNI19610 - RKEFDLNRQCGVINPETKKICTRLLTCK IHSVHQRREVPGRAKDFDVLVAELKASSRKGESPK

EKSPAHKEPALERPSQEPPTAVQGVAAVAAPNTTFSSLSKQTYPYCALPR RSHASSESEVDDEGPCGGDGDPGLFPFPLPRGGAQASSEESEEEGISDD

LHLSPDCHYATRPPRPQA FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMWK KKIPPAAEPPSHLVSPSLSDPLSPSPMGSCPRLPGPAPR

PACPASIPPVKDSLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSKGKEGVEMEAPSRKRKLSPGPTTFKRTCILEPAG

KGKPSSCRGLSTKTKTALNLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKASQLENRGVAGHPAKVLPTTCLSEEEVAKKRKNLATYCRPVKAKHCQAGV

PPDGTCSVRRKKPGPALPFEEKCSTLK SKAH
Transcript ENSMUST00000102633
Sequence
CTATTCGATCTACAGGGGTGCAGAGGCGCTTCGTGGCCGCCAGCCCAGGAAGGGGCGCCAGCCAGCTGGCGGATGCACGGCTTTAGAAGAGTATCTTGGG

CAGAAAGAGGTTTGGGGCTCGGGTATGCGCAGTAAGTTTGGGAGAGTGAACTAGTGGCACAAAGGACGTGTACGGAGGGGTTGAAAGAGGATATCCCGAG

GCTTTGATCTCTCCTTCCCCGCGTGCGATTGTGCATTTCGGAAGGGATCCCTCGGCTAGCTCCGTAAGCATCGCCACCCCTCCGCAACTACACTTCCCAG

AAAGCTGTGTTGAGAGTGAGGTAGTGGCAGGAGGCACGAGCTGCGCTTGCGCAGAGAGTGAACTGGCAAGGTAGGGGGAGAGGGAGGCGTGCCCCCGGTC

GGAGGGTGGGGGGAGGGGGCCGCGCGGCGGCGGCGCCAGGGCGGGCGCGCGTCCGCGGCGGTGATGGCGGTGCGTGAACGCGCGGTGGCAGCAATGGCCG

CTCTGGAGCGGCGAGTGCCGAGTCTCGATGACTTCGCGGGACAGAGCTGGAGCTCGTGGGTGGAGCGGGCCGACCTGCCTGCGGCAGACG AAACTGAGG

TACAAGGGCAACCCCTGGACAAAGCCCCCCTAAGAAGGGGAGGGGCTTGCGTAGCTGATCAAGGAGACTTTGAAGATGCCAAAGGGTCCAAAGACAACAG

TTTTTCTACTCTATGGCCATCCTATCAGTGCAGGACCTGAGAAGCTGAGTGTAACTTTGATGATACTATG GGGCTGAACTAGAGGAGAACAGCAAAAAC

ACGAAGAAACTTGACGCCATGACCCTCATTAAAGAAG - UNI19513 - - UNI20487 - ACATGTCCATCTTCGGGCACTGCCCTGCCCATGATG

ACTTCTATTTGGTTGTATGTAACCACTGCAGCCAGGTGGTGAAGCCCCAAGCCTTCCAGAAGCATTGCG - UNI20487 - AAAGAAGACATGGGCCC

CTCAGCAAGCTTTATGCCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCTCTCAAAAATGCCATGTAGTGAATGGGCAGGGCCCAGCTTGTAGAGCCC

CAGGTTCCACCAAAACCTCCTCCAGGGAGAAGGGCCAGGGGTCCCGGAGCCGTGGCCATCAGCCTCCTGAGAAGACCCAGAAGGACAGCCTCTG CCTTT

TCGTGCCTGTGGTGAATCTGGAGAAGATATCCAGTCTCCCGAAACCTGATGCACATGGAGTCAGGGTGGCCCCACCCTCTGCTCTCCTCAGTCAGCCAGG

AGGCCTCCCCAAGGACTCCCCTGGAAAAGTCCCCACGGCCCCCTCTCCTAAAGAACCTCCTGGCAGAGAGAACATCGAGCTTGTCCCCGGTGAGGGCTCC

AGTCACCGCGCCGAAGGCAGCCCCCCGGAGAAGGAGGCCAGTGGAGCCAGGCTTCCTCCTAAAACCCACCGAAAGATGGCTC - UNI19610 - GGAA

GGAGTTCGACCTCAACAGGCAGTGCGGGGTCATAAATCCAGAGACCAAGAAGATCTGTACACGCCTATTGACTTGCAAG ATCCACTCAGTGCACCAGCG

CAGGGAGGTCCCAGGCAGGGCCAAGGACTTTGATGTGCTAGTGGCCGAACTGAAGGCCAGCTCCCGAAAAGGAGAGTCTCCCAAGGAGAAGAGCCCAGCA

CACAAAGAGCCAGCTCTGGAGCGCCCATCCCAGGAGCCTCCCACTGCAGTCCAGGGTGTGGCAGCGGTAGCTGCCCCCAACACCACCTTCTCTTCTCTGT

CTAAGCAGACCTATCCGTACTGTGCACTCCCCAG GTCCCATGCCTCCTCTGAGAGTGAGGTGGATGACGAAGGTCCCTGTGGTGGTGATGGGGATCCAG

GCCTATTCCCCTTCCCTCTGCCCCGGGGTGGGGCCCAGGCCTCCAGTGAGGAGAGTGAGGAGGAGGGGATATCTGATGACCTCCACCTTTCCCCTGACTG

CCATTACGCAACTCGGCCCCCCAGGCCACAGGCG TTTTGCACATTTGGAAGCCGGCTGGTGAGCCCAGGATGCTATGTGTTTAGCCGCCGGCTGGACCG

GTTTTGCTCAGCACTCAGCTCCATGCTGGAACGGCATCTCAGCTCACACATGTGGAA GAAAATCCCACCAGCAGCCGAGCCTCCATCCCATCTTGTCAG

TCCATCTTTATCTGATCCCTTGAGTCCATCCCCTATGGGCAGCTGTCCCCGACTTCCAGGTCCAGCCCCCCGACCTGCCTGTCCAGCCTCCATACCCCCC

GTCAAGGACAGCCTTGTCCCTAGCTATCCTGCAGGCTCCCCCAGTGTAGCAGCTGCCTGCAGCCAGGCAGAGTGCATGGGCGGTAGCCAGGCTATTACCT

CACCGCTGCCTGCCAACACTCCATCTCCGTCCTTCAGCAAGCTGCCACCTTCCAAGGCCAGCAAGTCATCCAAAGGCAAGGAGGGGGTGGAGATGGAGGC

CCCTTCTCGAAAGCGGAAGTTATCCCCTGGCCCCACCACCTTCAAACGGACCTGCATCCTGGAGCCTGCTGGAAAGGGCAAACCCTCTAGCTGTCGGGGT

CTCTCAACCAAGACTAAAACAGCCCTGAACTTGGGGCTTAATGGAACAGTGGGGCCACGAGTGAAACGGGCCGGTCCCCTGGACTGTCGGGGTTCCCCTC

ATCCATCCCCCATACCCGTCAAGGCTTCTCAGCTAGAAAACCGAGGAGTGGCCGGACACCCAGCTAAGGTCCTGCCAACCACCTGCCTCTCCGAGGAGGA

GGTAGCCAAGAAGCGGAAAAACCTGGCCACTTACTGCCGGCCAGTCAAGGCCAAGCACTGTCAGGCTGGTGTCCCTCCTGATGGGACCTGCTCTGTGCGT

CGCAAGAAGCCAGGTCCAGCCCTGCCCTTTGAGGAGAAGTGCTCTACACTGAAG TCAAAAGCTCATTAACGAGAAAGTGCCTGCCCACTGCAACGGAGC

CGCCAGCACCTCCTCCCCTCCAGATCTGGGCCCCAGGCTGCTGCCGCTTTTTATAACTTTATATTATTTTTTTT
Translation
  MTLIKED - UNI19513 - - UNI20487 - DMSIFGHCPAHDDFYLVVCNHCSQVVKPQAFQKHCE - UNI20487 - ERRHGPLSKLYARA

PPPPPAPASSQKCHVVNGQGPACRAPGSTKTSSREKGQGSRSRGHQPPEKTQKDSLC CLFVPVVNLEKISSLPKPDAHGVRVAPPSALLSQPGGLPKDS

PGKVPTAPSPKEPPGRENIELVPGEGSSHRAEGSPPEKEASGARLPPKTHRKMAR - UNI19610 - RKEFDLNRQCGVINPETKKICTRLLTCK IH

SVHQRREVPGRAKDFDVLVAELKASSRKGESPKEKSPAHKEPALERPSQEPPTAVQGVAAVAAPNTTFSSLSKQTYPYCALPR RSHASSESEVDDEGPC

GGDGDPGLFPFPLPRGGAQASSEESEEEGISDDLHLSPDCHYATRPPRPQA FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMWK KKIPPA

AEPPSHLVSPSLSDPLSPSPMGSCPRLPGPAPRPACPASIPPVKDSLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSK

GKEGVEMEAPSRKRKLSPGPTTFKRTCILEPAGKGKPSSCRGLSTKTKTALNLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKASQLENRGVAGHPAKVL

PTTCLSEEEVAKKRKNLATYCRPVKAKHCQAGVPPDGTCSVRRKKPGPALPFEEKCSTLK SKAH

For any suggestions or comments, please send an email to unitrap@crg.es