Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049044 (Rapgef4)
Chromosomal location
Chr 2: 71819272 - 72095529 (+)
Description
Rap guanine nucleotide exchange factor (GEF) 4 Gene [Source:MGI (curated);Acc:Rapgef4-003]
RefSeq_dna
NM_019688 
RefSeq_peptide
NP_062662.1 
UniGene
Mm.196153 Mm.396676 
MGI
MGI:1917723 
Uniprot/SWISSPROT
Q9EQZ6 
Uniprot/SPTREMBL
A2ASW4 Q571A8 A2ASW3 A2ASW8 
Human Ortholog
ENSG00000091428 (RAPGEF4)
Omim not available
UniTrap UNI17050
Vector Insertion
Chr 2: 71819409 - 71869089
Public Clones IST10285D1 (tigm)
Private Clones OST450264 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30296
Vector Insertion
Chr 2: 71893082 - 71975298
Public Clones D033E04 (ggtc) 5SE289G09 (ggtc) IST13068F1 (tigm) IST14834A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35944
Vector Insertion
Chr 2: 71979230 - 72012479
Public Clones IST14488E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090826
Sequence
GGCCGCGGGAGCCCGCCGGGAGGCGCGCGGGAGGTGGCCGCGGCCCGGGGCCACCGCGCGCTGCTGCCCAACATGGTCGCTGCGCACGCTGCACACTCTC

AGTCCTCGGCCGAGTGGATCGCCTGCCTGGATAAAAG - UNI17050 - GCCGTTGGAGCGATCTAGTGAAGATGTGGACATAATTTTCACGCGGCTG

AAAGGAGTTAAAGCTTTTGAGAAATTTCACCCAAACCTCCTTCGTCAGATTTGTTTATGCGGTTACTATGAGAACCTGGAAAAAGGAATCACAC TGTTT

CGCCAAGGGGATATTGGAACCAACTGGTATGCTGTCCTGGCTGGGTCTTTGGATGTTAAAGTGTCTGAGACCAGCAGTCACCAG GATGCGGTGACCATC

TGCACTCTGGGAATTGGGACAGCCTTTGGAGAGTCCATTCTGGATAACACCCCTCGCCATGCAACCATCGTTACCAGGGAGAGCAGCGAACTTCTCCGCA

TTGAGCAGGAGGACTTCAAGGCACTATGGGAG - UNI30296 - AAATACCGACAGTATATGGCCGGACTTCTGGCTCCTCCCTATGGTGTTATGGAA

ACGGGCTCTAACAATGACA GGATTCCTGACAAGGAGAAT - UNI35944 - ACACCTCTCATTGAACCCCACGTTCCTCTCCGTCCTGCTCACACCA

TTACCAAG GTCCCTTCAGAGAAGATCCTCAGAGCTGGAAAAATTTTACGAATTGCCATTCTCTCTCGAGCTCCCCACATGATAAGAGACAGAAAGTACC

ACCTAAAGACATACAG ACAATGCTGTGTTGGGACTGAGCTGGTAGACTGGATGATACAGCAGACATCCTGTGTTCACTCGCGGACTCAAGCTGTTGGCA

TGTGGCAAGTCTTGCTGGAAGATGGTGTCCTCAACCATG TGGACCAGGAGCGCCATTTCCAAGACAAATATTTATTTTATCGATTTCTGGATGACGAGC

GTGAGGATGCCCCTTTGCCTACTGAGGAAGAGAAGAAGGAGTGTGATGAAGAACTTCAGGACACCATGCTGCTGCTCTCACAGATGGGCCCTGACGCCCA

CATGAGAATGATCCTGCGAAAACC ACCTGGCCAGAGGACTGTGGATGACCTAGAGATTATCTACGACGAGCTCCTTCATATTAAAGCCTTATCCCATCT

CTCTACCACA GTGAAACGGGAGTTAGCAGGTGTTCTCATTTTTGAGTCTCACGCCAAAGGAGGAACTGTGT TGTTTAACCAGGGGGAAGAAGGTACCT

CCTGGTACATCATTCTGAAAGGATCCGTGAATGTAGTCATTTATGGCAAG GGTGTGGTCTGCACCCTGCACGAAGGAGATGACTTTGGCAAGTTAGCTC

TAGTGAACGATGCTCCAAGAGCTGCCTCCATTGTTCTTCGGGAAGATAATTGTCACTTCCTAAGAGTCGACAAGGAAGACTTCAATCGGATTCTGAGG G

ACGTTGAGGCGAATACAGTCAGACTTAAAGAACATGACCAAGATGTCTTGGTACTGGAGAAGGTCCCAGCAGGGAACAGAGCTGCTAATCAAGGAAACTC

ACAGCCTCAGCAAAA GTATACTGTGATGTCAGGAACACCTGAAAAGATTTTAGAGCATTTTCTAGAAACAATACGCCTTGAGCCATCGTTGAATGAAGC

AACAG ATTCGGTTTTAAATGACTTTGTTATGATGCACTGTGTTTTTATGCCAAATACCCAGCTTTGCCCTGCCCTTGTGGCCCA TTACCACGCACAGC

CTTCTCAAGGTACCGAGCAGGAGAGAATGGATTATGCCCTCAACAACAAGAGGCGGGTCATCCGCTTGGTCCTGCAGTGGGCGGCCATGTATGGCGATCT

CCTCCAAGAAGATGATGTGGCCATGGCCTTCCTGGAG GAGTTCTATGTGTCTGTATCAGATGACGCACGGATGATGGCTGCCTTCAAGGAGCAGCTGCC

AGAGCTGGAGAAGATTGTCAAGCAAAT CTCAGAAGACGCAAAAGCTCCACAGAAGAAG CACAAGGTGCTTTTGCAACAGTTCAACACAGGTGACGAGA

GGGCCCAGAAGCGTCAGCCTATTCGTGGCTCTGATGAGG TTTTGTTCAAGGTCTACTGCATCGACCACACCTATACTACCATTCGTGTGCCGGTAGCTG

CCTCGGTGAAGGAAGTCATCAGTGCAGTAGCTGACAAACTGGGCTCAGGGGAAGGCCTGATCATCGTCAAGATGAACTCTGGAGGAG AAAAGGTGGTGC

TGAAATCTAATGATGTTTCAGTATTTACGACGCTCACCATTAATGGACGCCTGTTTGCCTGCCCGAGAGAGCAATTCGACTCACTG ACTCCCTTGCCGG

AACAGGAAGGCCCGACCACTGGGACAGTGGGAACATTTGAGCTGATGAGCTCGAAAGACCTGGCGTACCAGATGACAACCTACGATTGGGAACTCTTCAA

CTGTGTGCATGAG CTGGAGCTAATCTACCACACATTTGGAAGGCATAATTTTAAAAAGACCACGGCAAACTTGGATTTGTTCCTGAGGAGGTTTAATGA

AATTCAGTTTTGGGTTGTCACTGAGGTCTGCCTTTGTTCCCAGCTCAGCAAACGTGTTCAGCTTTTGAAAAAATTTATCAAGATAGCGGCTCA CTGCAA

GGAGTACAAAAATCTAAATTCCTTTTTCGCCATCGTCATGGGACTCAGCAACGTGGCCGTGAGCCGCTTGGCACTAACGTGGGAG AAACTGCCGAGCAA

GTTTAAGAAGTTCTATGCGGAGTTTGAGAGCTTGATG GATCCTTCCAGAAACCACAGGGCATACAGGCTGACAGCAGCCAAGCTGGAGCCCCCTCTCAT

CCCTTTCATGCCCTTGCTTATTAAAG ATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATG CGCATGA

TTGCAAACACTGCCAGAACAGTACGGTACTACAGGAGCCAGCCCTTCA ATCCGGATGCCGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATG

TACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGAAGGCCATAGACATCTGAAGTGCCCAGAGTGAT

GTTTTGTCTCCAGTCCACAATCTTTCAAAAGATGCTGTGTATGCTACTACTGACTGTGTTGCTACTAGAGAATTCTCCAGAATGAGCAAGAGACACATCC

TGAGAGCCCCTCGGGGCTACATCCTGCTTTCCAACCACACAGGAGAAGCGATCTGACTTGTCTAATGCTGCCATGCTGTAGCTTAGGAATCATCAGTTAT

AGTCACCCTCCTTCATTGTTGGCACGCCAGCACCAGGCTCACGTGAAGAAATAACCTTGGCGGGAGGCTACATCAGGGCCCTGACATCCCTTCCCAGGCT

GTTTGCAGCATGAGACTGTGCCATACGTAGATAGGTTTCACTCGGATGCGCCGGCGATGATATAATTGAATGAATTGTTTACTTAGCACCTTATTTGGGG

TCTGGGGTCTGGGGAGGGTATTGAGGATACCGTAAAAGTCCAAATTATACATCGTGTTCCTCCATGTTCATAATCTAACCTCTGAAGGAATGGAACCTCA

CCACAACACTATGAAACATTATGGCTGTTTCGTCTGTAATTTCGGAATGATCTATAGAATAATATGTTTACATTGTAACTTTTAAAAACTAACAAATCAG

GATTGCATACATAAGAATGCCACTAAGAAACACCAAGGTTCTTAATACCGCCAGCGTTAAGATAGAAAGTAACATTTCAGAAGAGCACAATATGCACAAA

ACATTTTTTCAAAATTTAAATATTTTCCTGGGCATTAAAAACGTTTCCACTACAAATTTATTGTTACTGATGAAAAAATGCATATTTTCTGGAGTTAAAT

GTTATTACAAAAATCTTAATTTTCAGCAATTGTTTTGCACTTTCAGATAGATTGTAAATAGGTTATGCAGTCAATGATATAGAGTTATTTATTTGCTACA

TAATAGACATTGTGCCAAATAATTCCTTTTTATTTATTTTATTCAGTATGAAATTTTGGAGTACATTTTTTCTGTTTTCTTAATTAGACCACATTTAATG

TATAGGAATTGTATGTACATATCTCTTCTGTAAATAACAGCCAGTATCTTCATTAAATATACTTGACAAG
Translation
MVAAHAAHSQSSAEWIACLDKR - UNI17050 - RPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITL LFRQGDIGTNWYAV

LAGSLDVKVSETSSHQ DAVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQEDFKALWE - UNI30296 - KYRQYMAGLLAPPYGVMETG

SNNDR RIPDKEN - UNI35944 - TPLIEPHVPLRPAHTITK VPSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYR RQCCVGTELVDWMIQQT

SCVHSRTQAVGMWQVLLEDGVLNHV VDQERHFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKP PPGQRTVDDLE

IIYDELLHIKALSHLSTT VKRELAGVLIFESHAKGGTVL LFNQGEEGTSWYIILKGSVNVVIYGK GVVCTLHEGDDFGKLALVNDAPRAASIVLRED

NCHFLRVDKEDFNRILR DVEANTVRLKEHDQDVLVLEKVPAGNRAANQGNSQPQQK KYTVMSGTPEKILEHFLETIRLEPSLNEATD DSVLNDFVMM

HCVFMPNTQLCPALVAH HYHAQPSQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVAMAFLE EFYVSVSDDARMMAAFKEQLPELEKIVKQI

 ISEDAKAPQKK HKVLLQQFNTGDERAQKRQPIRGSDEV VLFKVYCIDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMNSGGE EKVVLKSN

DVSVFTTLTINGRLFACPREQFDSL TPLPEQEGPTTGTVGTFELMSSKDLAYQMTTYDWELFNCVHE LELIYHTFGRHNFKKTTANLDLFLRRFNEIQ

FWVVTEVCLCSQLSKRVQLLKKFIKIAAH HCKEYKNLNSFFAIVMGLSNVAVSRLALTWE KLPSKFKKFYAEFESLM DPSRNHRAYRLTAAKLEPPL

IPFMPLLIKD DMTFTHEGNKTFIDNLVNFEKM RMIANTARTVRYYRSQPFN NPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Transcript ENSMUST00000102698
Sequence
GGCCGCGGGAGCCCGCCGGGAGGCGCGCGGGAGGTGGCCGCGGCCCGGGGCCACCGCGCGCTGCTGCCCAACATGGTCGCTGCGCACGCTGCACACTCTC

AGTCCTCGGCCGAGTGGATCGCCTGCCTGGATAAAAG - UNI17050 - GCCGTTGGAGCGATCTAGTGAAGATGTGGACATAATTTTCACGCGGCTG

AAAGGAGTTAAAGCTTTTGAGAAATTTCACCCAAACCTCCTTCGTCAGATTTGTTTATGCGGTTACTATGAGAACCTGGAAAAAGGAATCACAC TGTTT

CGCCAAGGGGATATTGGAACCAACTGGTATGCTGTCCTGGCTGGGTCTTTGGATGTTAAAGTGTCTGAGACCAGCAGTCACCAG GATGCGGTGACCATC

TGCACTCTGGGAATTGGGACAGCCTTTGGAGAGTCCATTCTGGATAACACCCCTCGCCATGCAACCATCGTTACCAGGGAGAGCAGCGAACTTCTCCGCA

TTGAGCAGGAGGACTTCAAGGCACTATGGGAG - UNI30296 - AAATACCGACAGTATATGGCCGGACTTCTGGCTCCTCCCTATGGTGTTATGGAA

ACGGGCTCTAACAATGACA GGATTCCTGACAAGGAGAAT - UNI35944 - GTCCCTTCAGAGAAGATCCTCAGAGCTGGAAAAATTTTACGAATTG

CCATTCTCTCTCGAGCTCCCCACATGATAAGAGACAGAAAGTACCACCTAAAGACATACAG ACAATGCTGTGTTGGGACTGAGCTGGTAGACTGGATGA

TACAGCAGACATCCTGTGTTCACTCGCGGACTCAAGCTGTTGGCATGTGGCAAGTCTTGCTGGAAGATGGTGTCCTCAACCATG TGGACCAGGAGCGCC

ATTTCCAAGACAAATATTTATTTTATCGATTTCTGGATGACGAGCGTGAGGATGCCCCTTTGCCTACTGAGGAAGAGAAGAAGGAGTGTGATGAAGAACT

TCAGGACACCATGCTGCTGCTCTCACAGATGGGCCCTGACGCCCACATGAGAATGATCCTGCGAAAACC ACCTGGCCAGAGGACTGTGGATGACCTAGA

GATTATCTACGACGAGCTCCTTCATATTAAAGCCTTATCCCATCTCTCTACCACA GTGAAACGGGAGTTAGCAGGTGTTCTCATTTTTGAGTCTCACGC

CAAAGGAGGAACTGTGT TGTTTAACCAGGGGGAAGAAGGTACCTCCTGGTACATCATTCTGAAAGGATCCGTGAATGTAGTCATTTATGGCAAG GGTG

TGGTCTGCACCCTGCACGAAGGAGATGACTTTGGCAAGTTAGCTCTAGTGAACGATGCTCCAAGAGCTGCCTCCATTGTTCTTCGGGAAGATAATTGTCA

CTTCCTAAGAGTCGACAAGGAAGACTTCAATCGGATTCTGAGG GACGTTGAGGCGAATACAGTCAGACTTAAAGAACATGACCAAGATGTCTTGGTACT

GGAGAAGGTCCCAGCAGGGAACAGAGCTGCTAATCAAGGAAACTCACAGCCTCAGCAAAA GTATACTGTGATGTCAGGAACACCTGAAAAGATTTTAGA

GCATTTTCTAGAAACAATACGCCTTGAGCCATCGTTGAATGAAGCAACAG ATTCGGTTTTAAATGACTTTGTTATGATGCACTGTGTTTTTATGCCAAA

TACCCAGCTTTGCCCTGCCCTTGTGGCCCA TTACCACGCACAGCCTTCTCAAGGTACCGAGCAGGAGAGAATGGATTATGCCCTCAACAACAAGAGGCG

GGTCATCCGCTTGGTCCTGCAGTGGGCGGCCATGTATGGCGATCTCCTCCAAGAAGATGATGTGGCCATGGCCTTCCTGGAG GAGTTCTATGTGTCTGT

ATCAGATGACGCACGGATGATGGCTGCCTTCAAGGAGCAGCTGCCAGAGCTGGAGAAGATTGTCAAGCAAAT CTCAGAAGACGCAAAAGCTCCACAGAA

GAAG CACAAGGTGCTTTTGCAACAGTTCAACACAGGTGACGAGAGGGCCCAGAAGCGTCAGCCTATTCGTGGCTCTGATGAGG TTTTGTTCAAGGTCT

ACTGCATCGACCACACCTATACTACCATTCGTGTGCCGGTAGCTGCCTCGGTGAAGGAAGTCATCAGTGCAGTAGCTGACAAACTGGGCTCAGGGGAAGG

CCTGATCATCGTCAAGATGAACTCTGGAGGAG AAAAGGTGGTGCTGAAATCTAATGATGTTTCAGTATTTACGACGCTCACCATTAATGGACGCCTGTT

TGCCTGCCCGAGAGAGCAATTCGACTCACTG ACTCCCTTGCCGGAACAGGAAGGCCCGACCACTGGGACAGTGGGAACATTTGAGCTGATGAGCTCGAA

AGACCTGGCGTACCAGATGACAACCTACGATTGGGAACTCTTCAACTGTGTGCATGAG CTGGAGCTAATCTACCACACATTTGGAAGGCATAATTTTAA

AAAGACCACGGCAAACTTGGATTTGTTCCTGAGGAGGTTTAATGAAATTCAGTTTTGGGTTGTCACTGAGGTCTGCCTTTGTTCCCAGCTCAGCAAACGT

GTTCAGCTTTTGAAAAAATTTATCAAGATAGCGGCTCA CTGCAAGGAGTACAAAAATCTAAATTCCTTTTTCGCCATCGTCATGGGACTCAGCAACGTG

GCCGTGAGCCGCTTGGCACTAACGTGGGAG AAACTGCCGAGCAAGTTTAAGAAGTTCTATGCGGAGTTTGAGAGCTTGATG GATCCTTCCAGAAACCA

CAGGGCATACAGGCTGACAGCAGCCAAGCTGGAGCCCCCTCTCATCCCTTTCATGCCCTTGCTTATTAAAG ATATGACATTTACTCATGAGGGGAACAA

GACGTTCATTGACAATCTAGTAAACTTTGAAAAAATG CGCATGATTGCAAACACTGCCAGAACAGTACGGTACTACAGGAGCCAGCCCTTCA ATCCGG

ATGCCGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTAAATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAG

ATTAGAGCCTCGAAGGCCATAGACATCTGAAGTGCCCAGAGTGATGTTTTGTCTCCAGTCCACAATCTTTCAAAAGATGCTGTGTATGCTACTACTGACT

GTGTTGCTACTAGAGAATTCTCCAGAATGAGCAAGAGACACATCCTGAGAGCCCCTCGGGGCTACATCCTGCTTTCCAACCACACAGGAGAAGCGATCTG

ACTTGTCTAATGCTGCCATGCTGTAGCTTAGGAATCATCAGTTATAGTCACCCTCCTTCATTGTTGGCACGCCAGCACCAGGCTCACGTGAAGAAATAAC

CTTGGCGGGAGGCTACATCAGGGCCCTGACATCCCTTCCCAGGCTGTTTGCAGCATGAGACTGTGCCATACGTAGATAGGTTTCACTCGGATGCGCCGGC

GATGATATAATTGAATGAATTGTTTACTTAGCACCTTATTTGGGGTCTGGGGTCTGGGGAGGGTATTGAGGATACCGTAAAAGTCCAAATTATACATCGT

GTTCCTCCATGTTCATAATCTAACCTCTGAAGGAATGGAACCTCACCACAACACTATGAAACATTATGGCTGTTTCGTCTGTAATTTCGGAATGATCTAT

AGAATAATATGTTTACATTGTAACTTTTAAAAACTAACAAATCAGGATTGCATACATAAGAATGCCACTAAGAAACACCAAGGTTCTTAATACCGCCAGC

GTTAAGATAGAAAGTAACATTTCAGAAGAGCACAATATGCACAAAACATTTTTTCAAAATTTAAATATTTTCCTGGGCATTAAAAACGTTTCCACTACAA

ATTTATTGTTACTGATGAAAAAATGCATATTTTCTGGAGTTAAATGTTATTACAAAAATCTTAATTTTCAGCAATTGTTTTGCACTTTCAGATAGATTGT

AAATAGGTTATGCAGTCAATGATATAGAGTTATTTATTTGCTACATAATAGACATTGTGCCAAATAATTCCTTTTTATTTATTTTATTCAGTATGAAATT

TTGGAGTACATTTTTTCTGTTTTCTTAATTAGACCACATTTAATGTATAGGAATTGTATGTACATATCTCTTCTGTAAATAACAGCCAGTATCTTCATTA

AATATACTTGACAAG
Translation
MVAAHAAHSQSSAEWIACLDKR - UNI17050 - RPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITL LFRQGDIGTNWYAV

LAGSLDVKVSETSSHQ DAVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQEDFKALWE - UNI30296 - KYRQYMAGLLAPPYGVMETG

SNNDR RIPDKEN - UNI35944 - VPSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYR RQCCVGTELVDWMIQQTSCVHSRTQAVGMWQVLLED

GVLNHV VDQERHFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKP PPGQRTVDDLEIIYDELLHIKALSHLSTT 

VKRELAGVLIFESHAKGGTVL LFNQGEEGTSWYIILKGSVNVVIYGK GVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILR D

VEANTVRLKEHDQDVLVLEKVPAGNRAANQGNSQPQQK KYTVMSGTPEKILEHFLETIRLEPSLNEATD DSVLNDFVMMHCVFMPNTQLCPALVAH H

YHAQPSQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVAMAFLE EFYVSVSDDARMMAAFKEQLPELEKIVKQI ISEDAKAPQKK HKVLLQ

QFNTGDERAQKRQPIRGSDEV VLFKVYCIDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMNSGGE EKVVLKSNDVSVFTTLTINGRLFACPR

EQFDSL TPLPEQEGPTTGTVGTFELMSSKDLAYQMTTYDWELFNCVHE LELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEVCLCSQLSKRVQL

LKKFIKIAAH HCKEYKNLNSFFAIVMGLSNVAVSRLALTWE KLPSKFKKFYAEFESLM DPSRNHRAYRLTAAKLEPPLIPFMPLLIKD DMTFTHEG

NKTFIDNLVNFEKM RMIANTARTVRYYRSQPFN NPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Transcript ENSMUST00000028525
Sequence
CTTTTAGACCAAGCGGAAGCCTGCTCCAATGACTTGGACCTGATGCCGGTACAAAGGTCTCACTCCGCAGTCCTCAAGTGTCTCCATGGAGTGACAAAAG

TTATTCAGGTCCAAAAAGGAAAGGAATGAAGTTGTTAGGAACTAACTAACATTAAAAAAAAAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAA

GAAGGAAAGAAAGAAAGAAAGAAAAAAGGAAGTCTTTGCTACCTGGGACTGGCCAAGCTTTCCTGGAGAGCCTTCAGTACTGCTTCCTCCCTGGGGACGC

AGAGGCTATCTGTTGGATTTGAATAGGGACCTGTCACTGATGTACACTGTGCTGTTCAGATAAAGGCTGGCTGCTTACTGGATGTCTGAGAACTTCCCGC

AACAGACGCATGCTCTACGAG - UNI30296 - AAATACCGACAGTATATGGCCGGACTTCTGGCTCCTCCCTATGGTGTTATGGAAACGGGCTCTAA

CAATGACA GGATTCCTGACAAGGAGAAT - UNI35944 - ACACCTCTCATTGAACCCCACGTTCCTCTCCGTCCTGCTCACACCATTACCAAG GT

CCCTTCAGAGAAGATCCTCAGAGCTGGAAAAATTTTACGAATTGCCATTCTCTCTCGAGCTCCCCACATGATAAGAGACAGAAAGTACCACCTAAAGACA

TACAG ACAATGCTGTGTTGGGACTGAGCTGGTAGACTGGATGATACAGCAGACATCCTGTGTTCACTCGCGGACTCAAGCTGTTGGCATGTGGCAAGTC

TTGCTGGAAGATGGTGTCCTCAACCATG TGGACCAGGAGCGCCATTTCCAAGACAAATATTTATTTTATCGATTTCTGGATGACGAGCGTGAGGATGCC

CCTTTGCCTACTGAGGAAGAGAAGAAGGAGTGTGATGAAGAACTTCAGGACACCATGCTGCTGCTCTCACAGATGGGCCCTGACGCCCACATGAGAATGA

TCCTGCGAAAACC ACCTGGCCAGAGGACTGTGGATGACCTAGAGATTATCTACGACGAGCTCCTTCATATTAAAGCCTTATCCCATCTCTCTACCACA 

GTGAAACGGGAGTTAGCAGGTGTTCTCATTTTTGAGTCTCACGCCAAAGGAGGAACTGTGT TGTTTAACCAGGGGGAAGAAGGTACCTCCTGGTACATC

ATTCTGAAAGGATCCGTGAATGTAGTCATTTATGGCAAG GGTGTGGTCTGCACCCTGCACGAAGGAGATGACTTTGGCAAGTTAGCTCTAGTGAACGAT

GCTCCAAGAGCTGCCTCCATTGTTCTTCGGGAAGATAATTGTCACTTCCTAAGAGTCGACAAGGAAGACTTCAATCGGATTCTGAGG GACGTTGAGGCG

AATACAGTCAGACTTAAAGAACATGACCAAGATGTCTTGGTACTGGAGAAGGTCCCAGCAGGGAACAGAGCTGCTAATCAAGGAAACTCACAGCCTCAGC

AAAA GTATACTGTGATGTCAGGAACACCTGAAAAGATTTTAGAGCATTTTCTAGAAACAATACGCCTTGAGCCATCGTTGAATGAAGCAACAG ATTCG

GTTTTAAATGACTTTGTTATGATGCACTGTGTTTTTATGCCAAATACCCAGCTTTGCCCTGCCCTTGTGGCCCA TTACCACGCACAGCCTTCTCAAGGT

ACCGAGCAGGAGAGAATGGATTATGCCCTCAACAACAAGAGGCGGGTCATCCGCTTGGTCCTGCAGTGGGCGGCCATGTATGGCGATCTCCTCCAAGAAG

ATGATGTGGCCATGGCCTTCCTGGAG GAGTTCTATGTGTCTGTATCAGATGACGCACGGATGATGGCTGCCTTCAAGGAGCAGCTGCCAGAGCTGGAGA

AGATTGTCAAGCAAAT CTCAGAAGACGCAAAAGCTCCACAGAAGAAG CACAAGGTGCTTTTGCAACAGTTCAACACAGGTGACGAGAGGGCCCAGAAG

CGTCAGCCTATTCGTGGCTCTGATGAGG TTTTGTTCAAGGTCTACTGCATCGACCACACCTATACTACCATTCGTGTGCCGGTAGCTGCCTCGGTGAAG

GAAGTCATCAGTGCAGTAGCTGACAAACTGGGCTCAGGGGAAGGCCTGATCATCGTCAAGATGAACTCTGGAGGAG AAAAGGTGGTGCTGAAATCTAAT

GATGTTTCAGTATTTACGACGCTCACCATTAATGGACGCCTGTTTGCCTGCCCGAGAGAGCAATTCGACTCACTG ACTCCCTTGCCGGAACAGGAAGGC

CCGACCACTGGGACAGTGGGAACATTTGAGCTGATGAGCTCGAAAGACCTGGCGTACCAGATGACAACCTACGATTGGGAACTCTTCAACTGTGTGCATG

AG CTGGAGCTAATCTACCACACATTTGGAAGGCATAATTTTAAAAAGACCACGGCAAACTTGGATTTGTTCCTGAGGAGGTTTAATGAAATTCAGTTTT

GGGTTGTCACTGAGGTCTGCCTTTGTTCCCAGCTCAGCAAACGTGTTCAGCTTTTGAAAAAATTTATCAAGATAGCGGCTCA CTGCAAGGAGTACAAAA

ATCTAAATTCCTTTTTCGCCATCGTCATGGGACTCAGCAACGTGGCCGTGAGCCGCTTGGCACTAACGTGGGAG AAACTGCCGAGCAAGTTTAAGAAGT

TCTATGCGGAGTTTGAGAGCTTGATG GATCCTTCCAGAAACCACAGGGCATACAGGCTGACAGCAGCCAAGCTGGAGCCCCCTCTCATCCCTTTCATGC

CCTTGCTTATTAAAG ATATGACATTTACTCATGAGGGGAACAAGACGTTCATTGACAATCTAGTAAACTTTGAAAAAATG CGCATGATTGCAAACACT

GCCAGAACAGTACGGTACTACAGGAGCCAGCCCTTCA ATCCGGATGCCGCTCAAGCTAATAAGAACCATCAGGATGTCCGGAGTTATGTACGGCAATTA

AATGTGATTGACAACCAGAGAACTTTATCACAGATGTCACACAGATTAGAGCCTCGAAGGCCATAGACATCTGAAGTGCCCAGAGTGATGTTTTGTCTCC

AGTCCACAATCTTTCAAAAGATGCTGTGTATGCTACTACTGACTGTGTTGCTACTAGAGAATTCTCCAGAATGAGCAAGAGACACATCCTGAGAGCCCCT

CGGGGCTACATCCTGCTTTCCAACCACACAGGAGAAGCGATCTGACTTGTCTAATGCTGCCATGCTGTAGCTTAGGAATCATCAGTTATAGTCACCCTCC

TTCATTGTTGGCACGCCAGCACCAGGCTCACGTGAAGAAATAACCTTGGCGGGAGGCTACATCAGGGCCCTGACATCCCTTCCCAGGCTGTTTGCAGCAT

GAGACTGTGCCATACGTAGATAGGTTTCACTCGGATGCGCCGGCGATGATATAATTGAATGAATTGTTTACTTAGCACCTTATTTGGGGTCTGGGGTCTG

GGGAGGGTATTGAGGATACCGTAAAAGTCCAAATTATACATCGTGTTCCTCCATGTTCATAATCTAACCTCTGAAGGAATGGAACCTCACCACAACACTA

TGAAACATTATGGCTGTTTCGTCTGTAATTTCGGAATGATCTATAGAATAATATGTTTACATTGTAACTTTTAAAAACTAACAAATCAGGATTGCATACA

TAAGAATGCCACTAAGAAACACCAAGGTTCTTAATACCGCCAGCGTTAAGATAGAAAGTAACATTTCAGAAGAGCACAATATGCACAAAACATTTTTTCA

AAATTTAAATATTTTCCTGGGCATTAAAAACGTTTCCACTACAAATTTATTGTTACTGATGAAAAAATGCATATTTTCTGGAGTTAAATGTTATTACAAA

AATCTTAATTTTCAGCAATTGTTTTGCACTTTCAGATAGATTGTAAATAGGTTATGCAGTCAATGATATAGAGTTATTTATTTGCTACATAATAGACATT

GTGCCAAATAATTCCTTTTTATTTATTTTATTCAGTATGAAATTTTGGAGTACATTTTTTCTGTTTTCTTAATTAGACCACATTTAATGTATAGGAATTG

TATGTACATATCTCTTCTGTAAATAACAGCCAGTATCTTCATTAAATATACTTGACAAGAAA
Translation
MLYE - UNI30296 - KYRQYMAGLLAPPYGVMETGSNNDR RIPDKEN - UNI35944 - TPLIEPHVPLRPAHTITK VPSEKILRAGKILRIA

ILSRAPHMIRDRKYHLKTYR RQCCVGTELVDWMIQQTSCVHSRTQAVGMWQVLLEDGVLNHV VDQERHFQDKYLFYRFLDDEREDAPLPTEEEKKECD

EELQDTMLLLSQMGPDAHMRMILRKP PPGQRTVDDLEIIYDELLHIKALSHLSTT VKRELAGVLIFESHAKGGTVL LFNQGEEGTSWYIILKGSVNV

VIYGK GVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILR DVEANTVRLKEHDQDVLVLEKVPAGNRAANQGNSQPQQK KYTV

MSGTPEKILEHFLETIRLEPSLNEATD DSVLNDFVMMHCVFMPNTQLCPALVAH HYHAQPSQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDD

VAMAFLE EFYVSVSDDARMMAAFKEQLPELEKIVKQI ISEDAKAPQKK HKVLLQQFNTGDERAQKRQPIRGSDEV VLFKVYCIDHTYTTIRVPVAA

SVKEVISAVADKLGSGEGLIIVKMNSGGE EKVVLKSNDVSVFTTLTINGRLFACPREQFDSL TPLPEQEGPTTGTVGTFELMSSKDLAYQMTTYDWEL

FNCVHE LELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEVCLCSQLSKRVQLLKKFIKIAAH HCKEYKNLNSFFAIVMGLSNVAVSRLALTWE 

KLPSKFKKFYAEFESLM DPSRNHRAYRLTAAKLEPPLIPFMPLLIKD DMTFTHEGNKTFIDNLVNFEKM RMIANTARTVRYYRSQPFN NPDAAQAN

KNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP

For any suggestions or comments, please send an email to unitrap@crg.es