Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000049106 (Wdr22)
Chromosomal location
Chr 12: 81437676 - 81537588 (-)
Description
WD repeat domain 22 Gene [Source:MGI Symbol;Acc:MGI:2444785]
Human Ortholog
not available
Omim not available
UniTrap UNI36435
Vector Insertion
Chr 12: 81505541 - 81537589
Public Clones IST14872E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054145
Sequence
GAGGGACGCGACCGTGAGGAAGCCGCGAACGCCGCCGACCGACCGTCTGCACACCTCGCTCCGTCTGCCATGGCTGGTTAAAGAAGCCTCCGGCTCGCTG

CGCGCGGGGAGGGACGGGACGGGAGGGGAGCGGCGGCCCGGCGTGCGGCCGAGGGAGGGGCGGCGGCGCGAGCTGCAGCGGCGGTGGCGGCGGCGGTTCC

AGCATGAAGAGGAGAGCTGGCCTGGGGGGCAGCATGAGGTCAGTGGTGGGCTTCTTGTCCCAGCGGGGCTTGCATGGGGACCCCCTGCTCACTCAGGACT

TTCAGAGGAGACGCCTGCGGGGCTGCAGAAACCTCTACAAGAAGGACCTTCTCGGCCACTTCGGCTGTGTCAATGCCATTGAATTCTCCAACAATGGAGG

CCAGTGGCTGGTCTCAG - UNI36435 - GAGGAGACGACCGCCGAGTTCTGCTATGGCACATGGAACAAGCTATCCATTCCAGGGTCAAACCCATAC

AGCTGAAAGGGGAACACCATTCCAACATTTTCTGCCTGGCTTTCAACAGTGGGAACACCAAAGTATTCTCTGGAG - UNI36435 - GAAATGATGAG

CAAGTTATCCTCCATGATGTTGAAAG CAGTGAGACCCTGGATGTGTTTGCTCATGAAGATGCAGTATATGGCTTGTCAGTGAGCCCCGTGAATGACAAC

ATTTTTGCCAGCTCTTCAGATGATGGCCGGGTTCTCATTTGGGATATCCGGGAGTCTCCCCATGGAG AGCCCTTCTGCCTGGCAAACTATCCGTCAGCC

TTTCACAGCGTCATGTTTAACCCCGTGGAGCCCCGGCTATTGGCCACAGCCAATTCAAAGGAAGGAGTGGGACTCTGGGACATTAGAAAGCCTCAGAG T

TCTCTCCTGCGCTATGGTGGCAACCTGTCTCTCCAGAGTGCCATGAGTGTGCGATTCAACAGCAATGGGACCCAACTCCTGGCACTGCGGCGCCGCCTGC

CCCCTGTCCTCTATGACATCCACTCCCGCCTGCCAGTGTTCCAGTTTGACAATCAGGGTTACTTCAACTCATGCACTATGAAAAGCTGCTGCTTTGCCGG

GGATCGTGACCAG TACATCCTTTCAGGCTCCGATGACTTCAACTTGTACATGTGGAAGATCCCTGCAGATCCAGAGGCAG GTGGCATTGGCAGGGTGG

TCAATGGAGCCTTCATGGTGCTGAAAGGGCATCGGTCCATCGTGAACCAGGTTCGGTTTAACCCCCACACCTATATGATCTGCTCTTCTGGCGTAGAAAA

GATTATCAAG ATCTGGAGCCCATACAAGCAGCCAGGATGTACAGGTGACCTGGATGGTCGGATTGAAGATGACTCCCGCTGCCTCTACACCCATGAGGA

GTACATTAGCCTTGTTCTGAACAGTGGAAGTGGCCTGTCCCACGACTACGCTAACCAGTCAGTCCAGGAGGACCCTCGGATGATGGCTTTCTTTGACTCC

TTGGTGCGTCGTGAAATTGAGGGCTGGAGCTCAGACTCGGACAGCGACCTCAGCGAGAGCACTATCCTCCAGCTGCACGCAGGGGTCAGTGAGCGCTCAG

GCTACACTGACTCGGAATCTTCAGCCTCACTGCCCCGCTCCCCACCTCCCACAGTAGACGAGTCTGCGGACAACGCCTTCCACCTGGGGCCCCTGCGCGT

CACTACCACAAATGCAGTGGCGTCAACCCCAGCAACGCCAACATGTGAGGATGCGTCCTCTCGGCAGCAGCGCCTGTCTGCTCTGAGGCGTTACCAGGAC

AAACGCCTCTTGGCCCTGTCCAATGAGTCCGATTCTGAAGAGAATGTTTGTGAGGCTGAACTGGACACAGATCTCTTCCCTCGGCCACGGTCGCCCAGCC

CTGAGGATGGGTCCAGCAGTCCCAGCAGCTCCACCAGCTCTGAGGATGAAGAGGAACTGAACCAACGCCGAGCCACCACCCGGCAGCGGAACGCCATGCG

GAGGCGACAAAAGACAGCCCGGGATGAGCGGCCCACTGGTCCAGCCAAGTCCACCAACACCTACATTGGAGAGGACAATTACGACTACCCACAGATCAAG

GTGGATGACCTCTCCCCCTCCCCAGACTCCTCCCCTGAGCGGAGCGCTTCCACTCTGGATGTTCAGCCAAGCCGGGCACCACCAGCCGCCAACATGGAAT

CAGTTGAGCGTAAGATTTACAAAGCTTACAAATGGCTCCGCTGCTCCTATATCTCTTACTCGAATAACAAAGATGGGGAAACCTCCTTAATGGCAGAGGA

GGCAGATGAAGGAAGAGCAGGAACCAGCCACAAAGACAACCCAACCCCTTCTTCCAGTAAGGAAGCCTGTCTAACAGCCACAGCCCAGAGGGACCAGGAC

CTGCCCTCTGAAGGCTGCAGCAGTGATGCTTGTAAAGAAGGGACTTCCGCCGGAAATCCCAACAGCGGTGCAGGCCATGAGCATAGTAGCCATCCTTGGG

CAGAGGTGCCAGAGGGCACCTCTCAGGACACTAACAACAGTGGCCCACTAGAACACTCTTTTGAAACCAAGAAGCTCAATGGAAAGGCTCTGAGCAAGGC

CCTGAGCAGTCGGGCTGAGGAGCCACCCGCCTCTCCTGGCCCCAAGGCATCGGGCTCTACTCTCAACAGTGCATCTGGCAACTGTCCCAGGACCCAGTCT

GATGACAGTGAGGAGAGGAGCCTTGACACTGTCTGTGCCAACCACAACAATGGACGCTTGCACCCCAGGCCCCTGCACCCCCACAACAATGGGCAGAGCT

CTGGGGAGCTGGAGACAGTGGCCTGCTCTTCCCCAGGACACCTAGACACTGACCATGATAGCCCATCCCTGACAGGGACATTTCTACACAAAGATTGTTG

TGGGTCGGAAATGGCCTGTGAGACCCCAAGTGCTGGAATGAGAGAGGACCCCCCTGACCCTTCAGGCCTGGACAGCAGCAAGGTTGTTCATGGCCAAAGC

GGCCTCAAAAGGCACCGAATTGAATTGGAAGATACAGAGTCAGAGAATTCCTCCTCAGAGAAGAAATTAAAAACATGATAAATACAAAGGGAAAACAAAA

GCTACAAAAAGTAGCCTTACAGAATAATTTTTCTTGTTTAGTGAACACAGAGGAAAGGAAAAAGTATTAAAGGCACATAAAACCAGGGCCTGAAACGTGT

CTGCTGCTGCTCCTTCTGTTAGCCGCTCTCCAGTGGGTCAGCATGTCTAGCTGGCACTGCCTCGCTCTCTGCTGAGGGCACTGCCAGCGGCTCTTCTCTA

GTGAGATGTGAGCATAGCATTCCTGTGCAGGTTCTGTGACGATGAGCCCGTCTTGGGACATTCGGCTTGTTCTGTGTGTGTGTGTCCACTAGCACATGTG

GGCTTGTTGTCTTAGGAGACCTTTCTTTTAACTGTCCATCAGCAAAGACCTGTGAATCTGTAGCTTTTGCCGTCACACCTGTCCATTGTTCATTTGACAT

GGTGTCCTGGTCCTAACAGTGTCTCTTAGATCAGATTGTGCTGCGGTGAGTTGTAAATTTATGCTAGCAGAAAGGAGATACAAATGGAAAGAGGCCTTCC

TTCAGCTCATTGGCTGTGCTGAAGAGGAAAACATGGCTCCTTTCTTAAATGTTCCATGTTTTCTCCAGCTGACATATCGCTGAGCTTCTACCGTGGCTCT

AAGTGGAGCATTGCCCATGCTAATAAGAGGTTGATGTGGAAGCTCAGATCCTGAGAGTGTCACTGTGTGCAGAAGGGGCAGAGCTACGATATGTGCTGTG

AGGTGCCGTACAATGACTAGTGGACAACACACTAACCATCTAGGTGCTGGGTTCCTAAGAGGCACGCAAGGCCAGCAGGTGCTTCCTTGGCTCCAGGTAA

TGGAGTCCAGGCACACTGAAAGGAAGGACCCCCTTGCTCTAATAAAATGGCTGGTAGAAGAATGCTAATGAGCTATAGTGGCGAGCAGAATGTGGTACTG

TGTTCTAGTCCAGTGCCAATTCATCAGTCAGAAATGGGGGCTGGCACCTTCTCTCAGGCGTGGAGTTGTCAGAGGCTGTGGGTTCCACCTGAACTTTGCA

GTGTGGTAACGTCTGTTAGGGGACAGGGGATATGGAGAGACAAGTCTCTGGTTTGTATCCTGGCTCCCAGAAGACATTCTGTTCTGTTGAAGTAGGTAAC

AATGGAGAGAAGAAAATATCAAACTTCCAGTGTGTAGTGGTGATTGTAGTCCCCGAGTTGTCAGTGAAGGGTTGTGCAAGACAGGAAGACCTAATTGGTG

TAGATGTTAAAAGCAAGAGGAAGATAGAACAGTGGAACTTTGGATGCAGAGGTGCTAGACAGCTGGAGCTTGGCTGGAACTGGCATAGGGAGGACTTAGC

ACAGGCAGCTGTGGCCTCCGTGAGCCAGCGTTGCTTTCTGAGGAGGACCTGTCCTGCTGGAATGGAGCCGAGAGAAGACCACCTGTGAAGGCTGAAGAAC

GGACGGACAGACGGACGGATGCTGCTCAGTGCTGAGAGCCAGGGTTCTTATAAAGGAAGGCAGTTGGTAAGAGCCAGGGGGATGTGTGGCATCTTTCTGA

GCTTCGCAGAAGGGAGATGTAGCGGCTGGAGTCTAGAAGCACGGTTTGAGAAGGAGAGGAAGGAAGGCGCCTGAGTAGGGTGGGGGTGGATACGGTCAGC

AGCTGGACTCTTCCTGGGAAGTGAGACAGTGACTCTGTAAACAACGTTAGAATTACTTTAGATTTGTAATCAAAATGGTTCTATGATTTATCTTTTGACT

ATTCACAGATAATTGTAAATTCTGGTTTTATAAGCCCAAGTCATTTTACGTTTGCCTTTTCAAAATTATTAAATTGGAATTTTTTAATCCTTTATATAC
Translation
MKRRAGLGGSMRSVVGFLSQRGLHGDPLLTQDFQRRRLRGCRNLYKKDLLGHFGCVNAIEFSNNGGQWLVSG - UNI36435 - GGDDRRVLLWHMEQ

AIHSRVKPIQLKGEHHSNIFCLAFNSGNTKVFSGG - UNI36435 - GNDEQVILHDVES SSETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVL

IWDIRESPHGE EPFCLANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPQS SSLLRYGGNLSLQSAMSVRFNSNGTQLLALRRRLPPVLYDIHS

RLPVFQFDNQGYFNSCTMKSCCFAGDRDQ YILSGSDDFNLYMWKIPADPEAG GGIGRVVNGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKIIK IW

SPYKQPGCTGDLDGRIEDDSRCLYTHEEYISLVLNSGSGLSHDYANQSVQEDPRMMAFFDSLVRREIEGWSSDSDSDLSESTILQLHAGVSERSGYTDSE

SSASLPRSPPPTVDESADNAFHLGPLRVTTTNAVASTPATPTCEDASSRQQRLSALRRYQDKRLLALSNESDSEENVCEAELDTDLFPRPRSPSPEDGSS

SPSSSTSSEDEEELNQRRATTRQRNAMRRRQKTARDERPTGPAKSTNTYIGEDNYDYPQIKVDDLSPSPDSSPERSASTLDVQPSRAPPAANMESVERKI

YKAYKWLRCSYISYSNNKDGETSLMAEEADEGRAGTSHKDNPTPSSSKEACLTATAQRDQDLPSEGCSSDACKEGTSAGNPNSGAGHEHSSHPWAEVPEG

TSQDTNNSGPLEHSFETKKLNGKALSKALSSRAEEPPASPGPKASGSTLNSASGNCPRTQSDDSEERSLDTVCANHNNGRLHPRPLHPHNNGQSSGELET

VACSSPGHLDTDHDSPSLTGTFLHKDCCGSEMACETPSAGMREDPPDPSGLDSSKVVHGQSGLKRHRIELEDTESENSSSEKKLKT

For any suggestions or comments, please send an email to unitrap@crg.es